PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G138500.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 1114aa    MW: 124796 Da    PI: 6.5438
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G138500.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.74.5e-23123224199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  Potri.006G138500.3 123 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI-- 210
                         99*****************************9445444.38************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         ++++ +l+++++r+
  Potri.006G138500.3 211 RDEKSQLLLGIRRA 224
                         45677789999997 PP

2Auxin_resp124.66.9e-41249331183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m+fete+s  rr++Gt++g+sd+dpvrW+nS+Wr+L+
  Potri.006G138500.3 249 AAHAAANNSPFTIFYNPRASPSEFVIPFSKYNKALYTQVSLGMRFRMMFETEESGVRRYMGTITGISDMDPVRWKNSQWRNLQ 331
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.94E-45113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-42115238IPR015300DNA-binding pseudobarrel domain
CDDcd100173.93E-20122223No hitNo description
SMARTSM010195.3E-24123225IPR003340B3 DNA binding domain
PROSITE profilePS5086312.365123225IPR003340B3 DNA binding domain
PfamPF023623.3E-21123224IPR003340B3 DNA binding domain
PfamPF065076.8E-36249331IPR010525Auxin response factor
PfamPF023093.0E-109801072IPR033389AUX/IAA domain
SuperFamilySSF542771.32E-89861064No hitNo description
PROSITE profilePS5174525.0929861079IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1114 aa     Download sequence    Send to blast
MKVPSNGFLP NFAEGERKCI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFIPSYPNL PSKLICMLHN VTLHADVETD EVYAQMTLQP YEKEALLASD MGLKQNRQPT  120
EFFCKTLTAS DTSTHGGFSV PRRAAEKIFP PLDFSMQPPA QELVARDLHD NTWTFRHIYR  180
GQPKRHLLTT GWSVFVSTKR LFAGDSVLFI RDEKSQLLLG IRRANRQQPA LSSSVISSDS  240
MHIGILAAAA HAAANNSPFT IFYNPRASPS EFVIPFSKYN KALYTQVSLG MRFRMMFETE  300
ESGVRRYMGT ITGISDMDPV RWKNSQWRNL QVGWDESTAG ERPSRVSIWE IEPVVTPFYI  360
YPPPFFRPKF PKQPGMPDDD SDIENAFKRA MPWLGDEFGM KDPPSSIFPG LSLVQWMSMQ  420
QNNQFPATQS GLFPSMVPSN ALHNNLSTDD PSKVLNFQAP GLSPPSVQLN KTNPQNQVGQ  480
LPQPPMAWTQ QQQLQQLLQT PINQQQPPYP HQQQQQPISQ QQQHQHWPQQ QQQQQPQLQP  540
PQIRQPPPQI QQHQQQQQIF QPPTLNDSVV APNQIPNQNL QQPVVYSQLQ QQQQLLASNT  600
QSQSIPSANK SSYPLTSLPQ DSQLHQQMEQ QSNLSQRQQQ QTQLQQSPLL LIQQNLSQRA  660
QPQQQQQQQL QQLSQPSHSE QQLHFQLLQK LQQHQQLPSP ASSVLQSQQL QQQQQQTHQQ  720
HQQLQQSPLS QNQQPLGSNS FSTAALMQTQ SFPMNQPQGL QKPPMAVRAR SSITDGEAPS  780
CSTSPSTNNC QISPQNFLNR NHLAPAMLMG DSAIEPASNL VQDLQNKSEI RVKNEFPSSR  840
GLDQLKYKGA VTDQLEASSS GTSYCLDAGN IQQNFSVPTF GLDSDVQSHP RNSLPFASNI  900
DALAPDTLLS RGYDSQKDLQ NLLANYGGTT RDIETELSTA AISSQSFAVP NIPFKPGCSN  960
DVAINDTGVL NNGLWTNQTN QTQRMRTYTK VQKRGSVGRS IDVTRYKGYN ELRHDLARMF  1020
GIEGQLEDPQ SSDWKLVYVD HENDILLVGD DPWEEFVSCV QSIKILSSAE VQQMSLDGDL  1080
GNVPVPNQAC SGTNSGNVWR GQYDDNSAAS FNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1721535245388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G138500.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024459018.10.0auxin response factor 19 isoform X2
TrEMBLA0A2K2A2250.0A0A2K2A225_POPTR; Auxin response factor
STRINGcassava4.1_000604m0.0(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19