PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G138500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 1142aa    MW: 127603 Da    PI: 6.4143
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G138500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.74.6e-23126227199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  Potri.006G138500.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVARDLHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI-- 213
                         99*****************************9445444.38************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         ++++ +l+++++r+
  Potri.006G138500.1 214 RDEKSQLLLGIRRA 227
                         45677789999997 PP

2Auxin_resp124.57.1e-41252334183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m+fete+s  rr++Gt++g+sd+dpvrW+nS+Wr+L+
  Potri.006G138500.1 252 AAHAAANNSPFTIFYNPRASPSEFVIPFSKYNKALYTQVSLGMRFRMMFETEESGVRRYMGTITGISDMDPVRWKNSQWRNLQ 334
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.03E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-42118241IPR015300DNA-binding pseudobarrel domain
CDDcd100174.08E-20125226No hitNo description
PfamPF023623.4E-21126227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.365126228IPR003340B3 DNA binding domain
SMARTSM010195.3E-24126228IPR003340B3 DNA binding domain
PfamPF065077.0E-36252334IPR010525Auxin response factor
PfamPF023093.1E-109831075IPR033389AUX/IAA domain
PROSITE profilePS5174525.0929891082IPR000270PB1 domain
SuperFamilySSF542771.37E-89891067No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1142 aa     Download sequence    Send to blast
MKVPSNGFLP NFAEGERKCI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDFIPSYPNL PSKLICMLHN VTLHADVETD EVYAQMTLQP VSKYEKEALL ASDMGLKQNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVARD LHDNTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPFS KYNKALYTQV SLGMRFRMMF  300
ETEESGVRRY MGTITGISDM DPVRWKNSQW RNLQVGWDES TAGERPSRVS IWEIEPVVTP  360
FYIYPPPFFR PKFPKQPGMP DDDSDIENAF KRAMPWLGDE FGMKDPPSSI FPGLSLVQWM  420
SMQQNNQFPA TQSGLFPSMV PSNALHNNLS TDDPSKVLNF QAPGLSPPSV QLNKTNPQNQ  480
VGQLPQPPMA WTQQQQLQQL LQTPINQQQP PYPHQQQQQP ISQQQQHQHW PQQQQQQQPQ  540
LQPPQIRQPP PQIQQHQQQQ QIFQPPTLND SVVAPNQIPN QNLQQPVVYS QLQQQQQLLA  600
SNTQSQSIPS ANKSSYPLTS LPQDSQLHQQ MEQQSNLSQR QQQQTQLQQS PLLLIQQNLS  660
QRAQPQQQQQ QQLQQLSQPS HSEQQLHFQL LQKLQQHQQL PSPASSVLQS QQLQQQQQQT  720
HQQHQQLQQS PLSQNQQPLG SNSFSTAALM QTQSFPMNQP QGLQKPPMAV RARSSITDGE  780
APSCSTSPST NNCQISPQNF LNRNHLAPAM LMGDSAIEPA SNLVQDLQNK SEIRVKNEFP  840
SSRGLDQLKY KGAVTDQLEA SSSGTSYCLD AGNIQQNFSV PTFGLDSDVQ SHPRNSLPFA  900
SNIDALAPDT LLSRGYDSQK DLQNLLANYG GTTRDIETEL STAAISSQSF AVPNIPFKPG  960
CSNDVAINDT GVLNNGLWTN QTNQTQRMRT YTKVQKRGSV GRSIDVTRYK GYNELRHDLA  1020
RMFGIEGQLE DPQSSDWKLV YVDHENDILL VGDDPWEEFV SCVQSIKILS SAEVQQMSLD  1080
GDLGSRAPAT DVVLGARAVD CPTAIPQILS PLLQLLPSDG SIPSSSTLDY IRESGQEAKD  1140
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1731535545388Auxin response factor 5
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G138500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381583.20.0auxin response factor 19 isoform X1
TrEMBLA0A2K2A2220.0A0A2K2A222_POPTR; Auxin response factor
STRINGcassava4.1_000604m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Representative plantOGRP9033914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19