PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G133000.5
Common NamePOPTR_0006s13530g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 317aa    MW: 33820.9 Da    PI: 6.7286
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G133000.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-1474118147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+eE++++++a +++  + Wk+I   +g  +t  q++s+ qky
  Potri.006G133000.5  74 RESWTEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 118
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.35E-1768124IPR009057Homeodomain-like
PROSITE profilePS5129416.29169123IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-772124IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-1972121IPR006447Myb domain, plants
SMARTSM007171.1E-1173121IPR001005SANT/Myb domain
PfamPF002497.7E-1274118IPR001005SANT/Myb domain
CDDcd001672.65E-976119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0032922Biological Processcircadian regulation of gene expression
GO:0043966Biological Processhistone H3 acetylation
GO:0046686Biological Processresponse to cadmium ion
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MIMNANSSSS TSTSTAGAGA ETGANPAGPS QSMATPTSSS TPPATGTGTG TTAAASSDGS  60
GKKVRKPYTI TKSRESWTEE EHDKFLEALQ LFDRDWKKIE DFVGSKTVIQ IRSHAQKYFL  120
KVQKNGTSAH VPPPRPKRKA SHPYPQKASK NVLVPLPASM AYASSMNTFA PGYALWDETS  180
VLINSATSKI MPSQDELPNL HGAEADIGPK CVSSSNNTVS GLGTSSRTLP SAEMPKQGKQ  240
APVLHGIPDF AEVYSFIGSV FDPDTKGHVE KLQEMDPINF ETVLLLMRNL TVNLSSPDFE  300
PYFTSLVDSE EGHVII*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.3040.0leaf
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00338DAPTransfer from AT3G09600Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G133000.5
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1483550.0EF148355.1 Populus trichocarpa x Populus deltoides clone WS01313_L11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381512.20.0protein REVEILLE 8 isoform X1
SwissprotQ8RWU31e-132RVE8_ARATH; Protein REVEILLE 8
TrEMBLA0A2K2A1N00.0A0A2K2A1N0_POPTR; Uncharacterized protein
STRINGPOPTR_0006s13530.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.21e-130MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Fogelmark K,Troein C
    Rethinking transcriptional activation in the Arabidopsis circadian clock.
    PLoS Comput. Biol., 2014. 10(7): p. e1003705
    [PMID:25033214]
  4. Xing H, et al.
    LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors.
    Plant Signal Behav, 2015. 10(3): p. e1010888
    [PMID:25848708]
  5. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]