PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G125400.2
Common NamePOPTR_0006s12730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 785aa    MW: 87059.3 Da    PI: 7.1656
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G125400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.91.3e-094991347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +WT +E+e + +a +q G++ +++I r+++  +   q++++++ +
  Potri.006G125400.2 49 AWTHQEEESFFNALRQVGKN-FEKITRHVQ-SKNKDQVRHYYYRL 91
                        6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.21E-114196IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-64494IPR009057Homeodomain-like
PROSITE profilePS5129315.0014596IPR017884SANT domain
SMARTSM007171.0E-64694IPR001005SANT/Myb domain
CDDcd001671.98E-64992No hitNo description
PfamPF002495.6E-74991IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MEPQVSLDSE RHLHRNSSIQ VGDPGVTSST PDRVEPRQPE KRPTRQWAAW THQEEESFFN  60
ALRQVGKNFE KITRHVQSKN KDQVRHYYYR LVRRMNKLLG PGLCLDAKNS KDTNAAMLRW  120
WSLLAKYSCK ASKLHLKPRR FKIFVEALEN QLLKDRRKNV RKRSSQGENG SPTTPSIITN  180
QNRASGHDTR TVKLVLVDSQ NIQKLGGGKG SLKRNVNLGV IRNNNKGDST AMKPARQRRK  240
PASSAAYKKW EKAAIAGVSL VADAAEHLER TAPDKEFEHD QGQNGLDSVE NVLPHLPASL  300
LHYVESSAHN NMKLKLQLFP IDDGTRRALE MDKHNPHLEL TLSTRKKISS VLEHLNRKWG  360
NSTVASGELM LFPYVVNREN LVGYQRWTQD SLVSAADVYL SIGSPPVFRL RYGWFSNANF  420
ASMTLRAPST YSCLTDGGNE KGKAMDSVST TEPSTGDQFL EDPSRDCPTS MNSNHASTPH  480
SAGVSNETNE FIAIGPINNL VKSFDPAANT SWHRTETDDR TSTQQLEDVD GLRLSNVNVL  540
SAGEWADSLT DVSIGDLLSE LPHEADFNCV EPPIVQSNQC LQQIPFSCDS FDAAIAAHIS  600
RHQSKVGFVS SVTSHTSSIW DGEETCDAFA FQRNHSLRKE VTTSAVASPQ VGKQMDRTSS  660
IASGAFLEEL PDFVGPMDYP TGEDRMCLSD LQVVNNQAKN FNGLTDIYWP DSLGLLDLDI  720
PSSKYHAEDL ILSDSLGGLN HLIASSLDAF QNCSFFGLNK KDSTSTVEAR ETTSFSDFKI  780
GSGI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers, roots and leaves. {ECO:0000269|PubMed:15047893}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G125400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024460382.10.0TSL-kinase interacting protein 1 isoform X1
RefseqXP_024460383.10.0TSL-kinase interacting protein 1 isoform X1
RefseqXP_024460384.10.0TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A2K2A1810.0A0A2K2A181_POPTR; Uncharacterized protein
STRINGPOPTR_0006s12730.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1