PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G117700.1
Common NamePOPTR_0006s11890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 233aa    MW: 27132.5 Da    PI: 8.811
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G117700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-1971124356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+ ++t++qle Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Potri.006G117700.1  71 KKKRLTSDQLESLEKSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWK 124
                         56779************************************************9 PP

2HD-ZIP_I/II118.34.1e-3870161192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekk+rl+++q+++LE+sF+ee kL+p+rK++l+reLglqprq+avWFqnrRAR+k+kqlE+ y+ Lk+++d++++e+++L++ev +L++ +
  Potri.006G117700.1  70 EKKKRLTSDQLESLEKSFQEEIKLDPDRKMKLSRELGLQPRQIAVWFQNRRARWKAKQLERLYDNLKQEFDSVSKEKQKLQEEVMKLKAVV 160
                         69*************************************************************************************9877 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Potri.006G117700.1 161 R 161
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.55E-1965128IPR009057Homeodomain-like
PROSITE profilePS5007117.70266126IPR001356Homeobox domain
SMARTSM003892.2E-1769130IPR001356Homeobox domain
PfamPF000466.8E-1771124IPR001356Homeobox domain
CDDcd000861.10E-1571127No hitNo description
Gene3DG3DSA:1.10.10.605.9E-2176125IPR009057Homeodomain-like
PRINTSPR000314.1E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000314.1E-5106122IPR000047Helix-turn-helix motif
PfamPF021831.7E-8126159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MNMDNMDWNG NFRSFVSRPD QTSFNFLYNY AYDPQYPGMD MKHPAILAEN APNRFVPTAL  60
DKITSYESQE KKKRLTSDQL ESLEKSFQEE IKLDPDRKMK LSRELGLQPR QIAVWFQNRR  120
ARWKAKQLER LYDNLKQEFD SVSKEKQKLQ EEVMKLKAVV REQATRKQVS TAGYTEISGE  180
ETVESTSVAA ASRKLRGHSH HQNNAEHCNY LLNVDEYNPV SSPYWALLPS YP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARWKAKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G117700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381334.11e-175putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR06e-56ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLU5GA011e-173U5GA01_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11890.11e-174(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33943466
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-58homeobox 51
Publications ? help Back to Top
  1. Zhao JL, et al.
    Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus.
    J Integr Plant Biol, 2015. 57(11): p. 925-35
    [PMID:25735194]
  2. Andres RJ, et al.
    Modifications to a LATE MERISTEM IDENTITY1 gene are responsible for the major leaf shapes of Upland cotton (Gossypium hirsutum L.).
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. E57-E66
    [PMID:27999177]
  3. Vuolo F, et al.
    LMI1 homeodomain protein regulates organ proportions by spatial modulation of endoreduplication.
    Genes Dev., 2018. 32(21-22): p. 1361-1366
    [PMID:30366902]