PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G117300.2
Common NamePOPTR_0006s11850g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 469aa    MW: 51307.6 Da    PI: 6.7459
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G117300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix51.62.5e-16108189186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W++  + +L++a+ e+ ++l+rg+l++ +Weev++ ++++   +s +qCk+k +nl+kryk ++++   + s s+s++p+f+++e
  Potri.006G117300.2 108 EWSDVAIGCLLDAYMEKFTQLSRGNLRGRDWEEVAAMVKQG---KSVEQCKNKVDNLKKRYKLERHRITTG-SISTSHWPWFQKME 189
                         5***********************************99997...699**********************99.677779*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.4E-17106191No hitNo description
Gene3DG3DSA:3.40.1160.104.7E-59241460IPR001048Aspartate/glutamate/uridylate kinase
SuperFamilySSF536333.93E-45252460IPR001048Aspartate/glutamate/uridylate kinase
CDDcd042545.04E-104254460No hitNo description
PfamPF006962.3E-21255461IPR001048Aspartate/glutamate/uridylate kinase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006221Biological Processpyrimidine nucleotide biosynthetic process
GO:0046939Biological Processnucleotide phosphorylation
GO:0005737Cellular Componentcytoplasm
GO:0033862Molecular FunctionUMP kinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MASSCDEDFS LLGDDNHHHH IIHHPYRYPT KSTPIHAPPE SVLPLDGEED RQDNNETDSA  60
FADVNPYSDN ETSKRSEREG EIDGGETPYN IYKRGRSGGG EYRKDREEWS DVAIGCLLDA  120
YMEKFTQLSR GNLRGRDWEE VAAMVKQGKS VEQCKNKVDN LKKRYKLERH RITTGSISTS  180
HWPWFQKMED IVGNSLTIKV APPAPAPADE DNGGGGASSA SVSRQSKRYA NTIASPAGQT  240
NNMMPKSISK TRWRRVILKI SGVALAGTGP NNIDPKVMTL IAREVAMACQ LGLEIAIVVG  300
ARNFFCGNTW VTATGSHRRT AYQIGMMASV MNSLLLQSAL EKTGIQTRVQ TAFAMQEVSE  360
PYSRQRAIRH LEKGRVVIFG GIGAGTGNPL FSTDTAAAVQ ASEIHAEAVL KGTNVDGVYD  420
CHSPDSNFIF EHISIRDLVS RGATSMDMTA LTFCEENNIP GCCGLQPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ek5_A1e-502474603214Uridylate kinase
3ek5_B1e-502474603214Uridylate kinase
3ek5_C1e-502474603214Uridylate kinase
3ek5_D1e-502474603214Uridylate kinase
3ek5_E1e-502474603214Uridylate kinase
3ek5_F1e-502474603214Uridylate kinase
3ek6_A1e-502474603214Uridylate kinase
3ek6_B1e-502474603214Uridylate kinase
3ek6_C1e-502474603214Uridylate kinase
3ek6_D1e-502474603214Uridylate kinase
3ek6_E1e-502474603214Uridylate kinase
3ek6_F1e-502474603214Uridylate kinase
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00340DAPTransfer from AT3G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381330.10.0hypothetical protein POPTR_0006s11850g
TrEMBLU5GCJ80.0U5GCJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11850.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10030.20.0Trihelix family protein