PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G115200.1
Common NamePOPTR_0006s11630g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 378aa    MW: 41999.5 Da    PI: 7.7465
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G115200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.38.8e-26150194145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCsr+v++g+k+CErHlhrgr+rsrk++e+
  Potri.006G115200.1 150 DPEPGRCRRTDGKKWRCSRDVVAGHKYCERHLHRGRNRSRKPVEN 194
                         79****************************************997 PP

2QLQ47.17.5e-1780115237
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         +F+ +Q+q+L+ Q+l+y+ ++a++ +PpeLlq+i+k
  Potri.006G115200.1  80 YFSLEQWQELELQALIYRFMLAGAAIPPELLQPIKK 115
                         6*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.1E-1079115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.81480115IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.7E-1380113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.138150194IPR014977WRC domain
PfamPF088798.0E-22151193IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MDFHLKQWRN QHEESGQQPS AKMPKLLMDP HQPQQHPHSS GSAAFPLFLP EPSCKNSNLS  60
AFPDSNTAAN TRLPKIMGNY FSLEQWQELE LQALIYRFML AGAAIPPELL QPIKKTLLHS  120
HPPPYFLHHP LQLHCSYYQP SWYWGRAAMD PEPGRCRRTD GKKWRCSRDV VAGHKYCERH  180
LHRGRNRSRK PVENPTPTIS TNITCIGIGE LDQTTFSLFC FCFNLLAHPY CSSKTESKGL  240
IGPPPPNEVG NRSDGHILWH FFDDWPRSVD ESDNMNAGSS MNSLTCLSVS MPGNSPASDV  300
SLKLSTGNNI AEEEPEPVPA PIPRGNTSNW AAAGWGTKIT NQVVTSMGGP LAEALRSSTT  360
KLISHECSAP VMSPHCF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G115200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024458787.10.0growth-regulating factor 4 isoform X2
SwissprotQ8L8A74e-87GRF4_ARATH; Growth-regulating factor 4
TrEMBLB9MTP80.0B9MTP8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Representative plantOGRP9959611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.12e-81growth-regulating factor 4
Publications ? help Back to Top
  1. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  2. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]