PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G086600.1
Common NamePOPTR_0006s08690g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 750aa    MW: 85094.3 Da    PI: 8.1493
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G086600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS384.41.3e-1173737441374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+a++++d + a++lL++++ ++sp gd ++Rla++f+ +L+arla+++s++yk l +++ts    ++ l+a++l+  ++P+ 
  Potri.006G086600.1 373 LRTLLINCAQAIAADDRRSANELLKQIRLHSSPFGDGNRRLAHCFADGLEARLAGTGSQIYKGLVSKRTS---AADLLKAYRLYLAACPFR 460
                         6789************************************************************999999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s+++ N++I   +e++ r+H+iDf+i +G+QWp++++ L++Rp+gpp+lR+Tg++ p++g   +e++eetg+rLa +A+e++vpfe+n+
  Potri.006G086600.1 461 KVSNFVSNKTIKITAENSMRLHVIDFGILYGFQWPTFIHRLSCRPGGPPKLRMTGIEFPQPGfrPAERVEETGRRLAAYAKEFKVPFEYNA 551
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +ak++e+++leeL+++++E+++Vn+ ++ ++llde+v+++s+r+ vL+lv++++P+v+++   +  +n++ +++rf eal ++sa+fd+l
  Potri.006G086600.1 552 -IAKKWETIQLEELKIDRDEVVVVNCLYRSKNLLDETVAVDSPRNIVLDLVRKINPEVFIHGITNGAYNAPFYVTRFREALFHFSAMFDML 641
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         e+ +pre+ er ++Er ++gre+ nv+aceg er+er et+++W+ r  +aGF +++++ +++kqa   +r+ + + + ++e+s +l++gW
  Potri.006G086600.1 642 ETIVPREELERLVIERDIFGREALNVIACEGWERVERPETYKQWQVRCLRAGFVQLSFDREIVKQATVKVRQRYHKDFLIDEDSRWLLQGW 732
                         **************************************************************************888************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r ++++SaW+
  Potri.006G086600.1 733 KGRIIYTLSAWK 744
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.957347724IPR005202Transcription factor GRAS
PfamPF035144.5E-115373744IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MDPRLRGYSI SVNGTQLGNQ PISVFSNQDP VSRPRFENTF VEHNCKEFHY IPPYPKPTDV  60
TPYSNPTQKE DSPEDFDFSD VTLRYINQML MEEDTEDKTC MLQDSLDLQV AEKSFYDVLG  120
KKYPPSPEPN PTFISQNRGN LPDSLPCNYI CSSRSDSGYV DDNAWIHNPS DYHSFQLQIP  180
HVSSISQSSY SSSNSVITTV DGLVDSPSSN FKVPDWSGES RSILHFRKGV EEASRFLPSG  240
NDLFLNIEAN KFLSQEPKVR TGEVAIKVEK QDGGEHSPSG PRGKKNPHRE DGDVEEGRSS  300
KQLAVYTEST LRSDMFDKVL LCIPGEGQPD LTALREAFKS ASIKNEQNGQ AKGSSGGKGR  360
GKKQSRKREV VDLRTLLINC AQAIAADDRR SANELLKQIR LHSSPFGDGN RRLAHCFADG  420
LEARLAGTGS QIYKGLVSKR TSAADLLKAY RLYLAACPFR KVSNFVSNKT IKITAENSMR  480
LHVIDFGILY GFQWPTFIHR LSCRPGGPPK LRMTGIEFPQ PGFRPAERVE ETGRRLAAYA  540
KEFKVPFEYN AIAKKWETIQ LEELKIDRDE VVVVNCLYRS KNLLDETVAV DSPRNIVLDL  600
VRKINPEVFI HGITNGAYNA PFYVTRFREA LFHFSAMFDM LETIVPREEL ERLVIERDIF  660
GREALNVIAC EGWERVERPE TYKQWQVRCL RAGFVQLSFD REIVKQATVK VRQRYHKDFL  720
IDEDSRWLLQ GWKGRIIYTL SAWKPAKKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-423777448375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308163.20.0hypothetical protein POPTR_0006s08690g
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLB9HBM90.0B9HBM9_POPTR; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein