PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G084200.1
Common NamePOPTR_0006s08440g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 327aa    MW: 34632.6 Da    PI: 9.0205
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G084200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.43.1e-3871130362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  Potri.006G084200.1  71 EPALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSK 130
                         6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3454123IPR003851Zinc finger, Dof-type
PfamPF027014.7E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22774128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDFSSIPAYL DPANWQQQPN HQTGVSSSTA TQHLPPPPPP PPQPHGSGGA GSIRPGSMAD  60
RARMANIPLP EPALKCPRCE STNTKFCYFN NYSLTQPRHF CKTCRRYWTR GGALRSVPVG  120
GGCRRNKRSK ESSSKSPISG YRQTGSCSSS TVSSNSGTSD TFGLGPQVPP MRFMAPLHHH  180
TEFASGNIGL NYGALSKTLV GGASDLNFQM GSALASAGLG GNGGAGGSLL SMGGFDQWRM  240
QQGQQLPFLG GLDSSASGLY PFEGGAEPSG YGGGADHIRP KISSSTATPL ASVKMEDNQE  300
LNMSRQFLGI PGNDQYPEWY FMDRSF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specific to both elongating procambial cells and to cells isodiametric in size that are presumably destined to develop into higher-order veins. Strongly expressed in advance of perceptible procambium formation. Expressed in the cells of prospective veins in leaf primordia of seedlings and cotyledons of developing embryos, and the vascular tissue of developing flower buds. {ECO:0000269|PubMed:17583520}.
UniprotDEVELOPMENTAL STAGE: Specific to the midveins, containing narrow procambial cell files. Expressed in procambial cells of leaf primordia, roots and embryos, prior to the completion of xylem differentiation. {ECO:0000269|PubMed:17583520}.
UniprotTISSUE SPECIFICITY: Expressed ubiquitously, especially in the vascular tissues, except in seeds, petals and anthers (PubMed:20807212). Specific to the vascular tissues in young leaves, cotyledons and flower buds (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). {ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:20807212, ECO:0000269|PubMed:30626969}.
UniprotTISSUE SPECIFICITY: Specific to the vascular tissues (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). {ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Binds to 5'-TAAAGT-3' motif in REV promoter to triggers its transcription, thus regulating adaxial-abaxial polarity and influencing leaf axial patterning in an auxin transport- and response-dependent manner (e.g. IAA6 and IAA19 genes expression) (PubMed:20807212). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:20807212, ECO:0000269|PubMed:30626969}.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements. Triggers the transcription of HD-ZIP III genes, especially in the central domain of vascular tissue (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G084200.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium. Antagonized by the HD-ZIP III proteins and by mobile miR165 and miR166 microRNAs. {ECO:0000269|PubMed:30626969}.
UniProtINDUCTION: By cytokinin in procambium. {ECO:0000269|PubMed:30626969}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308153.10.0dof zinc finger protein DOF5.1
SwissprotO809283e-58DOF24_ARATH; Dof zinc finger protein DOF2.4
SwissprotQ9LZ561e-57DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLB9HBK60.0B9HBK6_POPTR; Uncharacterized protein
STRINGPOPTR_0006s08440.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.18e-48DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]