PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G075500.2
Common NamePOPTR_0006s07520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-PHD
Protein Properties Length: 726aa    MW: 81660.2 Da    PI: 9.8756
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G075500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox322.1e-10507551953
                         HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
            Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                         ++ +e L ++F +n  ps++ +e L+k+lgL+  +V+ WF+N R+
  Potri.006G075500.2 507 PDAVEKLRQVFVENELPSRTVKENLSKELGLEPGKVSKWFKNSRY 551
                         67899**************************************97 PP

2PHD34.54.7e-12239293150
                         SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHT CS
                 PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCke 50 
                         +C+ C+      ++++vlCd +C+ +fH+kCl+++l++e++p g   w+C+ C++
  Potri.006G075500.2 239 FCAKCKLneVSPDNDIVLCDgTCNCAFHQKCLEPPLDTESIPPGdqGWFCKFCEC 293
                         699998865556********56********************9999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.54E-13231296IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.0E-11235293IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.291237294IPR019787Zinc finger, PHD-finger
CDDcd155041.36E-31239291No hitNo description
PfamPF006281.9E-9239293IPR019787Zinc finger, PHD-finger
SMARTSM002491.7E-7239292IPR001965Zinc finger, PHD-type
PROSITE patternPS013590240291IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.605.3E-12492550IPR009057Homeodomain-like
SuperFamilySSF466891.54E-10492551IPR009057Homeodomain-like
PROSITE profilePS5007112.39496556IPR001356Homeobox domain
SMARTSM003898.5E-10498560IPR001356Homeobox domain
CDDcd000867.13E-9499558No hitNo description
PfamPF000466.2E-8507551IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MGDSGKTSKL QDSHKCSPSD TVTGSLLIKS LKIKKDSKIS PRKGQKTKTK SKPKPIPHLK  60
TIISSAVSKR KVSPKGIGNG STSRKLIHRK ILHKALDKKA SRKGASSGLQ LSTIDSKGNG  120
KNGDEGAIKK LKKRKPKKRQ RDKVKLDEPS RLQRRARYLM IKMKLDQNLI DAYSGEGWKG  180
QSREKIRPEK ELLRARKQIL KCKLGLRDII RQVDSLSTVG CIEETVMAPD GSVSHEHIFC  240
AKCKLNEVSP DNDIVLCDGT CNCAFHQKCL EPPLDTESIP PGDQGWFCKF CECRMDIIEA  300
MNAHLGTHFS EDSSWQDIFT EEAAIPDAGN VLLNPEEEWP SDDSEDDNYD PERRDNIMSE  360
AGTDDDASDD ISSSTSLGWS SDGEVFLGSR RWEMHGLDFR NNSIYSSLDS DETSDGEIVC  420
GRRQRRAIDY KKLYDEVFGK DAPAHEQASE DEDWGPGKRK RREKESNAAS TLMTLCESKK  480
KSKSDETIEG MMNLPPQTRR PIFRLPPDAV EKLRQVFVEN ELPSRTVKEN LSKELGLEPG  540
KVSKWFKNSR YLALKSRKVE KGEQLHNSSS KVSAEPTLNV MEGKTADLSQ DSWEETEVCI  600
PKNLKRILQR KKLKSISRSL RKNEQKRGSY ESPTKSNEMN AECSDDVSLK KLLKAKPKGV  660
KKKVNPISVA AEYDMERLCR AKAILEKMKQ KVVKLQNGKA RKSSKTRPLE EFIVYIPIAE  720
LRGKN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128134KKLKKRK
2458463RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002309010.10.0hypothetical protein POPTR_0006s07520g
SwissprotP487851e-160PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLB9HAZ30.0B9HAZ3_POPTR; Uncharacterized protein
STRINGPOPTR_0006s07520.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-155pathogenesis related homeodomain protein A