PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G071600.1
Common NamePOPTR_0006s07100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 215aa    MW: 24587.5 Da    PI: 8.1482
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G071600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92.1e-1989143256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tk+q   Lee F+++++++ +++  LA++l+L+ rqV vWFqNrRa+ k
  Potri.006G071600.1  89 RKKLRLTKDQSSYLEESFRRHPTLNPAKKHALAEQLNLKPRQVEVWFQNRRARTK 143
                         678899***********************************************98 PP

2HD-ZIP_I/II121.54.1e-3989178190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rl+k+q++ LEesF+++ +L+p +K++la++L+l+prqv+vWFqnrRARtk+kq+E d+e Lk+++++l++en+rL++e +eLr++
  Potri.006G071600.1  89 RKKLRLTKDQSSYLEESFRRHPTLNPAKKHALAEQLNLKPRQVEVWFQNRRARTKLKQTEADCELLKKCCESLSNENRRLKRELQELRSQ 178
                         69*************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.19E-1975146IPR009057Homeodomain-like
PROSITE profilePS5007116.97385145IPR001356Homeobox domain
SMARTSM003892.1E-1687149IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-1889143IPR009057Homeodomain-like
PfamPF000461.1E-1689143IPR001356Homeobox domain
CDDcd000861.22E-1589146No hitNo description
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
SMARTSM003407.2E-18145188IPR003106Leucine zipper, homeobox-associated
PfamPF021837.2E-9145179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEEEGYCNTR LGLGLGGENY APWPQKQKEK PVVRLDLSFT LCPDQDDSMN IDHHGKAEGT  60
CFKSEEDEDY GNKRSDHSID NSCMYGTGRK KLRLTKDQSS YLEESFRRHP TLNPAKKHAL  120
AEQLNLKPRQ VEVWFQNRRA RTKLKQTEAD CELLKKCCES LSNENRRLKR ELQELRSQKT  180
GRSSSSHSQL AKDLGTITKC PSCEESTTTD QNKM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G071600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308994.11e-159homeobox-leucine zipper protein HAT9
SwissprotP466655e-48HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLB9HAM61e-158B9HAM6_POPTR; Uncharacterized protein
STRINGPOPTR_0006s07100.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56642851
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-50homeobox from Arabidopsis thaliana