PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G067800.1
Common NamePOPTR_0006s06700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 189aa    MW: 21234 Da    PI: 8.2184
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G067800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY206.11.3e-6391616170
               YABBY   6 sseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsv 96 
                           eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt++ svn+a a q l+ +++++       + + ++++  ++       s+s+ +
  Potri.006G067800.1   9 PNEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNIWSVNMAAAFQSLSWQDQVQ-------ASNYNSHDYRID-----LGSSSKCN 87 
                         579***********************************************999999732.......223333333333.....22333333 PP

               YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                         ++ ++ +   + v++   v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  Potri.006G067800.1  88 NKISMRTPAANIVTQERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 161
                         3333344555556666679*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.3E-719161IPR006780YABBY protein
SuperFamilySSF470955.11E-8106154IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.4E-4109155IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSSCIDAVPN EQLCYIPCNF CNIVLAVSVP CSSLFDIVTV RCGHCTNIWS VNMAAAFQSL  60
SWQDQVQASN YNSHDYRIDL GSSSKCNNKI SMRTPAANIV TQERVVNRPP EKRQRVPSAY  120
NQFIKEEIQR IKANNPDISH REAFSTAAKN WAHFPHIHFG LMLETNNQTK VDDGSEKRLM  180
SRSALQNN*
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G067800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308074.11e-140axial regulator YABBY 5
SwissprotQ8GW462e-86YAB5_ARATH; Axial regulator YABBY 5
TrEMBLB9HAJ01e-138B9HAJ0_POPTR; Uncharacterized protein
STRINGPOPTR_0006s06700.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Representative plantOGRP22101236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.28e-89YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]