PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G039700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 493aa    MW: 53960 Da    PI: 8.7705
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G039700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR155.32.1e-1760146191
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         ++Yn+YA++vGF + +++s+   ++g+ t   + Cs+ gk++   k+   + + +++++t+Ckak+++ ++ +g++++ +++l+HnHel+p
  Potri.006G039700.1  60 DYYNRYAQRVGFGIMRRSSRCD-DDGRLTYIVLSCSQCGKDRGIPKS---RFQWKQTSKTNCKAKINLVLNPQGQFHICNVVLDHNHELTP 146
                         69**************998887.8999**************999888...88899999******************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.4E-1560146IPR004330FAR1 DNA binding domain
HamapMF_0017027.741246473IPR020672Ribose-5-phosphate isomerase, type A, subgroup
SuperFamilySSF1009502.97E-33246392No hitNo description
Gene3DG3DSA:3.40.50.13601.3E-42248387No hitNo description
CDDcd013982.01E-77249462IPR004788Ribose 5-phosphate isomerase, type A
TIGRFAMsTIGR000211.6E-54250466IPR004788Ribose 5-phosphate isomerase, type A
PfamPF060262.3E-45296463IPR004788Ribose 5-phosphate isomerase, type A
SuperFamilySSF754451.07E-18376453No hitNo description
Gene3DG3DSA:3.30.70.2603.2E-22388451No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009052Biological Processpentose-phosphate shunt, non-oxidative branch
GO:0004751Molecular Functionribose-5-phosphate isomerase activity
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MEMESNSMVD VPLKKDIKVS SSDNEKVDEH GVSGVLLNGD GEVETPKIGM VFASQEEVRD  60
YYNRYAQRVG FGIMRRSSRC DDDGRLTYIV LSCSQCGKDR GIPKSRFQWK QTSKTNCKAK  120
INLVLNPQGQ FHICNVVLDH NHELTPGQLH PNICKKSKPF RTRKGREGKE QAGMMLHPDF  180
RSIFGEPLGS ETASPDSVMQ RPSFSNHLLN GDKHLLCSYT GLPKGEIISN RLKRRSPALE  240
GSQNSQDSLR HALAKRAVAL VKSGMVIGLG TGRTLTLVIE EIGKLIQEGK LKGIVAVGTN  300
YQSRITARQY GMTTVDLNDV NDIDIAFDVV DEVDINKNLL KCRGANHTVQ KVIDSMAKVC  360
ILLVEHTKVV HRLGNNIPVA VEVLPIAVSP VLRRLIALGG VPEIRSASRK DGSVITDLGN  420
MVVDVSFPSG IQNPADLEKN INMIPGVVDN GIFSSVATIV LVVVRDRGNI KVMNLEEFLE  480
GVPGHRDASS SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1lk5_A6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk5_B6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk5_C6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk5_D6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk7_A6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk7_B6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk7_C6e-472474664222D-Ribose-5-Phosphate Isomerase
1lk7_D6e-472474664222D-Ribose-5-Phosphate Isomerase
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G039700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027247.10.0PREDICTED: probable ribose-5-phosphate isomerase 3, chloroplastic
TrEMBLA0A2K1ZWF00.0A0A2K1ZWF0_POPTR; Uncharacterized protein
STRINGPOPTR_0006s03820.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1642057
Representative plantOGRP1037723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32250.42e-11FAR1-related sequence 2