PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G016200.2
Common NamePOPTR_0006s01720g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 547aa    MW: 61198.1 Da    PI: 5.443
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G016200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS404.88.7e-1241765461374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+++Ll+cA+avs+ d ++   l+  l +++s +g+p+qRl ay++e+L+arl  s+s++y+al++++     ss+ ++++ ++++++P+ 
  Potri.006G016200.2 176 LKHVLLACADAVSNADIQRSAGLMHVLDQMVSVSGEPIQRLGAYMLEGLRARLELSGSKIYRALKCEAPI---SSDLMTYMGILYQICPYW 263
                         689******************************************************************9...9999999*********** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++  aN  I eave e r+HiiDf+i qG QW+ L+q La+Rp+gpp + iTgv++++s   +   l  +g+rL+k+Ae+++vpfef+ 
  Potri.006G016200.2 264 KFAYTSANVVIREAVEYEPRIHIIDFQIAQGSQWILLMQMLACRPGGPPAIHITGVDDSQSAdaRGGGLDIVGQRLSKVAESCNVPFEFHD 354
                         **********************************************************9998888999*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          va +  +++le+Lrv+pgEa++Vn+ + lh+++desv++ ++rd+++++vkslsP++v+++eqe+++n+++F+ rf+e+l+yy+a+f+s+
  Potri.006G016200.2 355 -VAMDGCEVQLEHLRVQPGEAVVVNFPYVLHHMPDESVNTWNHRDRLIRMVKSLSPRIVTLIEQESNTNTKPFFPRFIETLDYYAAMFESI 444
                         .6888999*********************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +a+ + + ++ri+ E+++++r+ivn++ace+aer+erhe l+kWr+r+++aGF+++pl+++a++ +k ll++++ d y+v+e++ +l+l W
  Potri.006G016200.2 445 AAGSSMDFKQRINAEQQCVARDIVNMIACEEAERVERHELLAKWRSRFTMAGFNQYPLGSSATTAVKDLLKEYHRD-YSVQERDWALYLRW 534
                         **999999******************************************************************66.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         +dr + + SaWr
  Potri.006G016200.2 535 RDRDMATSSAWR 546
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.587150527IPR005202Transcription factor GRAS
PfamPF035143.0E-121176546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MQTSQKHRSA GIHGFYHQPV QEIDPYGLSH IQILDKTLYS DAGSQGTSVS FETCLGQFFT  60
LESSSATAGF VVYDSPAASI SSNRSPFSSQ GSHSCISDPR HSPENMYGSP LSGSSSADDG  120
NILRQKLREL EISLLGPESD ITDSGSFCFV SGGYQAEPYA SWDWNQMMEM IPRLDLKHVL  180
LACADAVSNA DIQRSAGLMH VLDQMVSVSG EPIQRLGAYM LEGLRARLEL SGSKIYRALK  240
CEAPISSDLM TYMGILYQIC PYWKFAYTSA NVVIREAVEY EPRIHIIDFQ IAQGSQWILL  300
MQMLACRPGG PPAIHITGVD DSQSADARGG GLDIVGQRLS KVAESCNVPF EFHDVAMDGC  360
EVQLEHLRVQ PGEAVVVNFP YVLHHMPDES VNTWNHRDRL IRMVKSLSPR IVTLIEQESN  420
TNTKPFFPRF IETLDYYAAM FESIAAGSSM DFKQRINAEQ QCVARDIVNM IACEEAERVE  480
RHELLAKWRS RFTMAGFNQY PLGSSATTAV KDLLKEYHRD YSVQERDWAL YLRWRDRDMA  540
TSSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-481805468375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.145110.0bud| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308802.10.0hypothetical protein POPTR_0006s01720g
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLB9HCV90.0B9HCV9_POPTR; Uncharacterized protein
STRINGPOPTR_0006s01720.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13