PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G258700.1
Common NamePOPTR_0005s28010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 1073aa    MW: 118588 Da    PI: 7.9375
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G258700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.23.2e-40144221178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C+++l++ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  Potri.005G258700.1 144 MCQVDNCKENLTTAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 221
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-33139206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.556142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-37143223IPR004333Transcription factor, SBP-box
PfamPF031102.6E-29145218IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MEKVGAQVAA PMFIHQALSS RYCDLASMAK KRDLSYQMPN FQLQQHHFLE TSLEKNWNSK  60
AWDWDSVGFV ARPSDAAETS RLGTASRETK KKDESDYKTK SNSANEDDGL GLNLGGSLTS  120
VEEPVSRPNK RVRSGSPANG SYPMCQVDNC KENLTTAKDY HRRHKVCEVH SKATKALVGK  180
QMQRFCQQCS RFHPLTEFDE GKRSCRRRLA GHNRRRRKTQ PEDVTSRLLV PGNQDINSNG  240
NLDIVNLLTA LARSQGRADD KSTTCTTVPD KDQLIQILSK INSLPLPMDL AAKLSNIASL  300
NGKNPDQPSS AHQNRLHGTA SSSSTVDLLA VLSATLAASA PDALAILSQR SSQSSDSDKS  360
KLTGPNQVTG SDLQKRSNIE FPSVGGERVS YCYESPVEDS DCQIQESRPN FPLQLFSSSP  420
ENDSPPKLAS SRKYFSSDSS NPIEDRSPSS SPPVAQKLFP LQSTAETMKS EKMSISREVN  480
ANVEGSRSHA CVLPLELFRG SNREPDHGSF QNFPYQGGYT SSSGSDHSPS SQNSDSQDRT  540
GRLIFKLFDK DPSHFPGTLR TQIYNWLSNS PSEMESYIRP GCVVLSVYLS MSSAAWEQLE  600
RNLLQQVNSL VQDSDSDLWR SGRFLLNTGG QLASHKDGKI RLCKSWRTWS SPELISVSPV  660
AVVGGQETSL QLKGRNLTSP GTKIHCMHMG GYTLKEITDS TSPGSIYDEI NMGGFKIHGP  720
SPSILGRCFI EVENGFKVNS FPVIIADASI CKELRLLESE FDEKAKVGDI VSEEQAHDLG  780
RPRSREEVLH FLNELGWLFQ RKRESSILEV PDFSLSRFRF LLIFSVERDY CVLVKTILDM  840
LVERNMCRDE LSKESLEMLS EVQLLNRSVK RSCRKMVDLL IHYSIVSHDN SSRTYIFPPN  900
VRGPGGITPL HLVACASGSD GLVDALTNDP HEIGLSCWNS LLDANGQSPY AYALMTKNHS  960
YNLLVARKLA DKINAQVSVT IGNEIEQPAL EQEHGAVSQF QQGRKSCAKC AIVAAKFHKR  1020
VPGSQGLLQR PYVHSMLAIA AVCVCVCLFF RGAPNIGLVA PFKWENLDFG TI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30135218184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G258700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456224.10.0squamosa promoter-binding-like protein 14
RefseqXP_024456225.10.0squamosa promoter-binding-like protein 14
RefseqXP_024456226.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2AMS40.0A0A2K2AMS4_POPTR; Uncharacterized protein
STRINGPOPTR_0005s28010.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Representative plantOGRP71381115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]