PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G251700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 917aa    MW: 101338 Da    PI: 6.1705
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G251700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.3e-29610660252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Potri.005G251700.1 610 EKTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKKV 660
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.552599680IPR003035RWP-RK domain
PfamPF020423.0E-25612660IPR003035RWP-RK domain
SuperFamilySSF542775.61E-22820912No hitNo description
PROSITE profilePS5174524.801830913IPR000270PB1 domain
SMARTSM006668.3E-23830913IPR000270PB1 domain
PfamPF005644.6E-17831912IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.4E-22831910No hitNo description
CDDcd064071.72E-37831910No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MMEDGVLSPG MMLGAAVDSA MDFDYMDELL LEGCWVETTD GSEFLNPSLS NSAALFDPSF  60
MWPSPEMNNG NPASSLSQKG SQEVSHIPLL PGNSPSDIQS RSPVGEIAVS AAGWEYNATE  120
GSELGKRWWI GPAPNPSPGT TVKRRLIKAV ECIKDLTKNK DVLIQIWVPV NRGGRRVLTT  180
HDQPFALDPS SERLASYRDI SVKYQFSAEK DSKDSVGMPG RVFLGKVPEW TPDVRFFRND  240
EYPRVNHAQQ CDVRGTLALP VFEQGSRTCL GVIEVVTTSQ KIKYLPELES VCKALEAVDL  300
RSSEVPSIQN LKACDMSYQA ALPEIQKVLR AACETHRLPL AQTWVPCIQQ GKGGCRHSNE  360
NYYHCVSTVD DACCVGDPAF QGFLEACSEH HLLKGQGVVG EAFMTNQPCF SGDVTLYGKT  420
EYPLSHHARI FGLCAAVAIR LRSMYTGTTD FVLEFFLPVD CRDPQEQKTM LTSLSIIIQR  480
VCQTLRVVTV KELEEETDLP VSEVLVPSDG RSSGEETSTV KESYSERNAR DNSPWTACLL  540
KVQQSESNAS LSEKDKEKVM CEKSFESRHN QEDYSLRGST KYGGDSTSAE GSFSSVCKTK  600
PGEKRRAKTE KTITLQVLRQ YFAGSLKDAA KSIGVCPTTL KRICRQHGIN RWPSRKIKKV  660
SHSLQKLQCV IDSVEGAPGS VQIGSFYENF PELASPNSSR NSSLSTLNPS SHPKPSGIQL  720
EGGTFSSHVA EPKSPSPSCS LSSSSSHSYS STTQQYPSAI TVSASEDPKL GENLGSGVLK  780
KIRSNAELHA SILEERKLML RSQSHTTLTE LGNRPPLPKD SSRLSQEMDG HRVKVSFRND  840
KIRLRMPNNW VFKDLLQEII RRFNLDDMHR YDLKYLDDDS EWVLLACDDD LEECIDVCGS  900
GDNQTIKLLI EVSPHP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G251700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024457172.10.0protein NLP5
RefseqXP_024457173.10.0protein NLP5
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A2K2AMD30.0A0A2K2AMD3_POPTR; Uncharacterized protein
TrEMBLA0A385JI310.0A0A385JI31_POPTO; NIN-like protein 1
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein