PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G227900.1
Common NamePOPTR_0005s24950g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 291aa    MW: 32322 Da    PI: 8.8097
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G227900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.81.9e-3171128260
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         +++rY+eCl+NhAa++Gg ++DGCgEfmp  geeg+ +alkCaAC+CHRnFHRre + e
  Potri.005G227900.1  71 SNTRYRECLRNHAANVGGSVYDGCGEFMPG-GEEGSLEALKCAACECHRNFHRREIDGE 128
                         5789*************************9.999*********************8865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.3E-2873125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2273126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.3E-2874125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.17175124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.06E-18211281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-30218282IPR009057Homeodomain-like
TIGRFAMsTIGR015652.7E-29222279IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEIRGLENDI RTSVPSSYSH QSSGLEGRNG NHNGTTVLTY TQTLDHQRQP SRSPNPDRLA  60
IISSGPNSKT SNTRYRECLR NHAANVGGSV YDGCGEFMPG GEEGSLEALK CAACECHRNF  120
HRREIDGETQ FSPGSRRSAT MVHSLQLPPP LPSPAVLHHH HHHHQRYSMG LHTSPNTANM  180
VQPMSVAFGG VSGGTESSSE DLNPFQSNAD GVPPPPPYVM SKKRFRTKFT PEQKDKMMEF  240
ADKVGWRINK QDDEEVHKFC AEVGVRRQVF KVWMHNNKNL KKQPQPTSST *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-242212791674ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.145120.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Binds DNA at 5'-ATTA-3' consensus promoter regions. Regulates floral architecture and leaf development. Regulators in the abscisic acid (ABA) signal pathway that confers sensitivity to ABA in an ARF2-dependent manner. {ECO:0000269|PubMed:16428600, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21779177}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G227900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and ARF2. {ECO:0000269|PubMed:21779177}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306871.10.0zinc-finger homeodomain protein 5
SwissprotQ9FRL53e-68ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLB9H8Q90.0B9H8Q9_POPTR; Uncharacterized protein
STRINGPOPTR_0005s24950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-53homeobox protein 24