PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G192000.1
Common NamePOPTR_0005s21420g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 588aa    MW: 65833.6 Da    PI: 6.3471
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G192000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix957.1e-3063147187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r+ m+  +r+++lk+plWeevs+k++e g++rs+k+Ckek+enl k++k++keg+ ++++++  t+++fd+lea
  Potri.005G192000.1  63 RWPRQETLALLKIRSAMDAVFRDSSLKGPLWEEVSRKLAELGYHRSAKKCKEKFENLYKYHKRTKEGRTGKSEGK--TYKFFDELEA 147
                         8********************************************************************975544..6******985 PP

2trihelix102.14.2e-32408493187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev+aLi +r +++ ++++  +k+plWe++s+ m++ g++rs+k+Ckekwen+nk++kk+ke+++kr +++s+tcpyfdql+a
  Potri.005G192000.1 408 RWPKVEVQALISLRADLDIKYQEHGAKGPLWEDISAGMQKLGYNRSAKRCKEKWENINKYFKKVKESNRKR-PGDSKTCPYFDQLDA 493
                         8*********************************************************************8.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.18956120IPR017877Myb-like domain
SMARTSM007170.02360122IPR001005SANT/Myb domain
CDDcd122031.06E-2462127No hitNo description
PfamPF138371.7E-2062147No hitNo description
SMARTSM007175.1E-4405467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-4407464IPR009057Homeodomain-like
CDDcd122033.70E-26407472No hitNo description
PROSITE profilePS500907.085407465IPR017877Myb-like domain
PfamPF138379.9E-23407494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MLGDSSVLAS SSDVATTATR VVPEGGEVCE VGDAGGFGSN STEEDKNMGG DHEGDRMNYG  60
ANRWPRQETL ALLKIRSAMD AVFRDSSLKG PLWEEVSRKL AELGYHRSAK KCKEKFENLY  120
KYHKRTKEGR TGKSEGKTYK FFDELEAFQN HHSHSAQPPT ILAPPLPPPK AQTPTATTAT  180
LPWTNSPAIV SHVTVQSTTN PIDILSQGIA TPTTIHSTIS PMPLSSNSLN PSQDTLPSSL  240
QNLATHLFSS STSSSTASDE KLEGSRKRKR KRNWKDFFLR LTRDVIKKQE DLQKKFLETV  300
EKCEHERMAR EDAWRMKEMA RMNRQHEILI QERSTAAAKD AAVFAFLQKI SGQQNSTETQ  360
AIPQPKLTPP PTQPPQPRPP PTSLEPVTNL VVSKWDNGEN VTVSSSSRWP KVEVQALISL  420
RADLDIKYQE HGAKGPLWED ISAGMQKLGY NRSAKRCKEK WENINKYFKK VKESNRKRPG  480
DSKTCPYFDQ LDALYKEKNK MESRVSTGYA VKPISTMEPL MVSPEQQCPF EQANQPETII  540
EDNERDINID HNIEEDDDDM DDDTEEEDEG VGFEVVANRP ASLTNGE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265270RKRKRK
2265271RKRKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3157820.0JN315782.1 Populus tomentosa SANT DNA-binding domain-containing protein (GT2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307497.10.0hypothetical protein POPTR_0005s21420g
SwissprotQ391171e-147TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9H7S10.0B9H7S1_POPTR; Uncharacterized protein
STRINGPOPTR_0005s21420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-131Trihelix family protein