PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G191900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 609aa    MW: 67986 Da    PI: 6.5383
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G191900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix926.1e-2966150187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r+ m+ ++r+++ k+plWeevs+k++e g++rs k+Ckek+en+ k++k++k+g+ ++  ++ +t+++fdqlea
  Potri.005G191900.1  66 RWPRQETLALLKIRSGMDVAFRDASVKGPLWEEVSRKLAELGYNRSGKKCKEKFENVYKYHKRTKDGRTGK--QEGKTYRFFDQLEA 150
                         8********************************************************************96..45557*******85 PP

2trihelix1019.6e-32434519187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k ev aLi++r++++ +++++  k+plWee+s++mr+ g++r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  Potri.005G191900.1 434 RWPKVEVEALIRIRTNLDCKYQDNGPKGPLWEEISARMRKLGYNRNAKRCKEKWENINKYFKKVKESKKKR-PEDSKTCPYFQQLDA 519
                         8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.01559123IPR017877Myb-like domain
SMARTSM007170.008763125IPR001005SANT/Myb domain
CDDcd122038.39E-2565130No hitNo description
PfamPF138373.3E-1865150No hitNo description
PROSITE profilePS500907.503427491IPR017877Myb-like domain
SMARTSM007170.049431493IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-4433490IPR009057Homeodomain-like
PfamPF138371.7E-22434520No hitNo description
CDDcd122036.37E-25434494No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MLGDSSSVLA TTTTSTPGGG GGGGGAGDHK EAPPLTGGNH EGGSNDVGGE EDKGKIEGDR  60
SYGGSRWPRQ ETLALLKIRS GMDVAFRDAS VKGPLWEEVS RKLAELGYNR SGKKCKEKFE  120
NVYKYHKRTK DGRTGKQEGK TYRFFDQLEA FESHPPSLSS PLSLPPQPPK APTPAVTAIA  180
MPVVNPSPNI VRASHSTVPS TAAATLATNM SQGIVTSAII YLTVPPFPST NPTILPPSQA  240
TNPTNPPHTN IPPSFPNFSP DLISNSTSSS TSSDVELQER RKRKRKWKDF FERLMKEVIQ  300
KQEEMQKKFL EAIERREHER MVREESWRMQ EMTRINRERE ILAQERSVAA SKDAAVMAFL  360
QKLSEEQNPG QIQNNPPPSQ PPRPPAPPPI LQLVPTPPPP LPQAVANVDM IMKSDNGDQN  420
FTSASPSTSA SPSRWPKVEV EALIRIRTNL DCKYQDNGPK GPLWEEISAR MRKLGYNRNA  480
KRCKEKWENI NKYFKKVKES KKKRPEDSKT CPYFQQLDAL YKEKNKIDGP SNMKPENSVP  540
LMVRPEQQWP PPQQEHRPDS EMEDLESDDH QNHDDEDDKN MDDEDEEEDE ASGYEVVANK  600
QTSMNTDE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279284RRKRKR
2279285RRKRKRK
3280285RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2276020.0CU227602.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044212.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-147TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLB9H7S00.0B9H7S0_POPTR; Trihelix DNA-binding family protein
STRINGPOPTR_0005s21410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-133Trihelix family protein