PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G190300.1
Common NamePOPTR_0005s21260g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 463aa    MW: 52198.1 Da    PI: 4.6819
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G190300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS224.45.3e-69984523373
                GRAS   3 elLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         + Ll+ A+av+ ++ +la++++a +sel  +  d + +  +++yft++L+ +  + ++ l    +  e   + + e+++ ++++ e+sP++
  Potri.005G190300.1  98 DFLLTGAQAVEVSNWHLASNIIAGISELllSQTDENLFSDMVFYFTQGLSYKCRD-TPAL----AFHEIV-HAQNETMSHFQMLKELSPYV 182
                         579999*********************98455555899***************99.2222....222222.23567788899********* PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         +f+++taNqaIlea+ +e++vHi+D+di+ G+QWp+L+  La+R++   slRiT+++  +++++  +++tg+rL +fAe++g +f+f+ ++
  Potri.005G190300.1 183 RFAQFTANQAILEATREENEVHILDLDIMDGIQWPPLMADLAQRNNV--SLRITAIVG-DPEKAALVQHTGRRLVEFAESVGQTFKFDQMT 270
                         ********************************************776..9*****998.6779999***********************87 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesFlerflealeyysalfd 269
                          ++ ed+  e++  + g +l+ n++++  ++ d+++ + +   ++L+ v +lsPk+vv+ve+e    ++ +s sF+e f ea+++y+al d
  Potri.005G190300.1 271 IEKEEDF--EKI--EGGHTLIANCMIHQLHMTDRNLLVVK---NFLSGVSRLSPKLVVLVEEEllnfLKVSSVSFVEFFREAIQHYTALSD 354
                         7665555..555..779********999999988888888...9*******************8776678999****************** PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee.aGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                         sl+ +++r   e    E   +g +i++ v      r    e++++W+e ++    Fkp+p+s ++++qak l    +  gy v++e+  l 
  Potri.005G190300.1 355 SLQYSYGRVGFELFQKET--MGLRIMDSVRSFPIGR----EEKMSWEESFSLlKNFKPIPMSATNVSQAKQLSGLLG-IGYWVQNENSRLS 438
                         *****9877766655555..59********999994....44667*****98579*********************9.99*********** PP

                GRAS 360 lgWkdrpLvsvSaW 373
                         l+Wk+rpL+++S+W
  Potri.005G190300.1 439 LCWKSRPLTTASSW 452
                         ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.66870434IPR005202Transcription factor GRAS
PfamPF035141.8E-6698452IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MNCEQAPLIY YNTELQCNLE IASAFPTEKD NLDTDQFIES LLQMEADCMD EAGINNRCGS  60
HTSTSPVNQE SGSLVTSIDE TVHFVGFQES NGSNTFTDFL LTGAQAVEVS NWHLASNIIA  120
GISELLLSQT DENLFSDMVF YFTQGLSYKC RDTPALAFHE IVHAQNETMS HFQMLKELSP  180
YVRFAQFTAN QAILEATREE NEVHILDLDI MDGIQWPPLM ADLAQRNNVS LRITAIVGDP  240
EKAALVQHTG RRLVEFAESV GQTFKFDQMT IEKEEDFEKI EGGHTLIANC MIHQLHMTDR  300
NLLVVKNFLS GVSRLSPKLV VLVEEELLNF LKVSSVSFVE FFREAIQHYT ALSDSLQYSY  360
GRVGFELFQK ETMGLRIMDS VRSFPIGREE KMSWEESFSL LKNFKPIPMS ATNVSQAKQL  420
SGLLGIGYWV QNENSRLSLC WKSRPLTTAS SWIPRHALGS RH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3013845243374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2084810.0AC208481.1 Populus trichocarpa clone JGIACSB1081-L10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306689.20.0hypothetical protein POPTR_0005s21260g
TrEMBLB9H7Q60.0B9H7Q6_POPTR; Uncharacterized protein
STRINGPOPTR_0005s21260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8945915
FabidsOGEF131482130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.12e-37GRAS family protein