PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G188900.1
Common NamePOPTR_0005s21130g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 302aa    MW: 34046.8 Da    PI: 4.5672
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G188900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.31.2e-362887362
              zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        e+a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG++rnvPvGgg+rk ++++
  Potri.005G188900.1 28 EAAPNCPRCASRNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSIRNVPVGGGCRKYRRAK 87
                        56779**************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-272085IPR003851Zinc finger, Dof-type
PfamPF027015.0E-313085IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1273185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MYSATDQMMF QCPPRPLPKE KKWKSKVEAA PNCPRCASRN TKFCYYNNYS LSQPRYFCKG  60
CRRYWTKGGS IRNVPVGGGC RKYRRAKSSK VSQNERAAVS VNYSRTNETT LACSTNKDSM  120
AQQGGANGSD IDLAVVFAKF LNQDLSYEPD FTGEELLNEG GDQMVDVSNS SNPSDSFQND  180
SMMESLKRSD QIQESNLLEG QSQVLVGEKQ RLEEERIQEL IESQDMNAFG LQDLLSDEIV  240
QDALWSDDAT LTNFPNWQPM LQLQDFDSFS VDDRLKISSN FISDNSWSSL DLSGFEVFSR  300
P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183188ESLKRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.122500.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G188900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2227461e-150CU222746.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307484.30.0dof zinc finger protein DOF1.2
TrEMBLA0A2K2AIV20.0A0A2K2AIV2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s21130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.12e-41Dof family protein