PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G186500.2
Common NamePOPTR_0005s20890g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 585aa    MW: 65353.7 Da    PI: 4.7724
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G186500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4517.7e-1382155842374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL+ecA+a+s+g+ e+a+al+++l++l+s +gdp qR+aay++e+Laa++a+s+  lykal+++e +   s+++laa+++++e++P++k
  Potri.005G186500.2 215 RRLLFECANAISEGNIEKASALINELRQLVSIQGDPPQRIAAYMVEGLAAHMAESGMYLYKALKCKEPP---SDDRLAAMQILFEICPCFK 302
                         689*****************************************************************9...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         f++++aN a+ ea++ge+rvHiiDfdi+qG Q+++L+q+La++p++ p+lR+Tgv++pes+      l+++g+rL+k+Ae+l+vpfef++ 
  Potri.005G186500.2 303 FGFMAANGAMIEAFKGERRVHIIDFDINQGSQYITLIQTLANQPGKLPNLRLTGVDDPESVqrPVGGLRNIGQRLEKLAEALKVPFEFHA- 392
                         ***********************************************************99888899***********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         va++++ +++++L++kpgEal+Vn+++qlh+++desvs+ +erd++L++ ksl+Pk+v+vveq++++n+++F+ rf+ea +yysa+fdsl+
  Potri.005G186500.2 393 VASKTSVVSPSMLNCKPGEALVVNFAFQLHHMPDESVSTVNERDQLLRMAKSLNPKLVTVVEQDVNTNTAPFFPRFTEAYNYYSAVFDSLD 483
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         a+lpres++r +vE+++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF++ ++s ++++ ++ l+++++++ y+++ee g+l +gW+
  Potri.005G186500.2 484 ATLPRESQDRLNVEKQCLARDIVNIVACEGEERIERYEVAGKWRARMKMAGFTSCSISPSVVDLIRKLIKQYSDR-YMLKEEVGALHFGWE 573
                         *************************************************************************66.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         d++Lv++SaW+
  Potri.005G186500.2 574 DKSLVFASAWK 584
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.969188565IPR005202Transcription factor GRAS
PfamPF035142.6E-135215584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MSLVGSAELS ARAYGNNKLY SLKGSNDNSG LSAKIFGPDK RQNMYMTDSY SCESYEKFFL  60
DSPTEEIIQP SSSDISGNSA HPQGASSYQP RKSSGSTMFP QDPYNASFNL TTPCDGYPFI  120
SESDYLDIES PYQLDYDEYK MKLKLQELER ALLEDNEEDG MFGNSQSMEM DVEWSDPIQN  180
GMLHDSPKES SSSDSNLSSF SSNKEVSQLS PRTPRRLLFE CANAISEGNI EKASALINEL  240
RQLVSIQGDP PQRIAAYMVE GLAAHMAESG MYLYKALKCK EPPSDDRLAA MQILFEICPC  300
FKFGFMAANG AMIEAFKGER RVHIIDFDIN QGSQYITLIQ TLANQPGKLP NLRLTGVDDP  360
ESVQRPVGGL RNIGQRLEKL AEALKVPFEF HAVASKTSVV SPSMLNCKPG EALVVNFAFQ  420
LHHMPDESVS TVNERDQLLR MAKSLNPKLV TVVEQDVNTN TAPFFPRFTE AYNYYSAVFD  480
SLDATLPRES QDRLNVEKQC LARDIVNIVA CEGEERIERY EVAGKWRARM KMAGFTSCSI  540
SPSVVDLIRK LIKQYSDRYM LKEEVGALHF GWEDKSLVFA SAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-512185848375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164550.0AC216455.1 Populus trichocarpa clone POP032-C02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306674.20.0SCARECROW-LIKE 1 family protein
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLB9H7M70.0B9H7M7_POPTR; SCARECROW-LIKE 1 family protein
STRINGPOPTR_0005s20890.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1