PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G161500.1
Common NamePOPTR_0005s17390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 266aa    MW: 30781.1 Da    PI: 5.8521
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G161500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.6e-1857110356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q+++Le+ Fe ++++  e++ +LA++l L+ rqV +WFqNrRa++k
  Potri.005G161500.1  57 KKRRLTLHQVKALEKNFEVDNKLVPERKLKLAEELCLQPRQVAIWFQNRRARWK 110
                         56689************************************************9 PP

2HD-ZIP_I/II118.82.9e-3856148193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qvk+LE++Fe ++kL perK +la+eL lqprqva+WFqnrRAR+ktkqlE+dy +Lk++y+al+ + ++Le+++e+L++++
  Potri.005G161500.1  56 EKKRRLTLHQVKALEKNFEVDNKLVPERKLKLAEELCLQPRQVAIWFQNRRARWKTKQLERDYGTLKANYEALNLDYSNLEQKNEALAQKV 146
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 ke 93 
                         ke
  Potri.005G161500.1 147 KE 148
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.69852112IPR001356Homeobox domain
SuperFamilySSF466893.21E-1854114IPR009057Homeodomain-like
SMARTSM003892.3E-1555116IPR001356Homeobox domain
CDDcd000861.50E-1457113No hitNo description
PfamPF000462.3E-1557110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-1859119IPR009057Homeodomain-like
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PfamPF021833.2E-14112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MKRFNSSDSL AAFISITSSK EDRTQNTNQG YSRDFQAMLD SLEEEDYIEE ANLGSEKKRR  60
LTLHQVKALE KNFEVDNKLV PERKLKLAEE LCLQPRQVAI WFQNRRARWK TKQLERDYGT  120
LKANYEALNL DYSNLEQKNE ALAQKVKELK AKLREEIVDS SHSVKEEYHV SESDNNASVH  180
SQNHDFSEHK NSSAVTKDHS NVSSSNELMN CFNLTDSRAI LGNRYQVYQP HLMKLEEQSL  240
FSAEESCNFF SVDQAPTLHC YFPEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.120470.0bud| catkin| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G161500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383504.10.0homeobox-leucine zipper protein ATHB-6 isoform X1
TrEMBLU5GG670.0U5GG67_POPTR; Uncharacterized protein
STRINGPOPTR_0005s17390.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18683489
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-59homeobox protein 16