PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G158800.1
Common NamePOPTR_0005s17620g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 258aa    MW: 27728.6 Da    PI: 6.9193
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G158800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.3e-3258113258
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                         +++rY+eC+kNhA+ +Ggha+DGCgEfm++ geegt +alkCaAC+CHRnFHR+e++
  Potri.005G158800.1  58 SSIRYRECQKNHAVGIGGHALDGCGEFMAA-GEEGTLDALKCAACNCHRNFHRKETD 113
                         5789*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.4E-2960112IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2361113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.5E-2961111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.54162111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.14E-20180252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-32181253IPR009057Homeodomain-like
TIGRFAMsTIGR015652.1E-25194250IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEFDEHEDQE EEMTGMAVMP PGYDSISNSA TARSKMGPTG GGGEGASTTA ANTNTRKSSI  60
RYRECQKNHA VGIGGHALDG CGEFMAAGEE GTLDALKCAA CNCHRNFHRK ETDGGGGGEV  120
ILYHGHHHQQ QPQFPPYYRA PPPAGYLHHL TPTPQPRPLA LPAASGGGYS REEEDVSNPS  180
SSGGGGGGGG SSSKKRFRTK FSQEQKEKMV AFAERLGWRI QKHDEAAVEQ FCAENGVKRH  240
VLKVWMHNNK HTIEIGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-291932521675ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.119920.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and, to a lower extent, in inflorescence, stems and leaves. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G158800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306552.20.0zinc-finger homeodomain protein 2
SwissprotQ6YXH57e-75ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
SwissprotQ9SB611e-75ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLB9H6X70.0B9H6X7_POPTR; Uncharacterized protein
STRINGPOPTR_0005s17620.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-64homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]