PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G150700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 70aa    MW: 7770.04 Da    PI: 10.5908
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G150700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.51.5e-271059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRr g+lKKA+EL +LCdaev v+ifsstgkly++ss
  Potri.005G150700.1 10 RIDNSTSRQVTFSKRRGGLLKKAKELAILCDAEVGVMIFSSTGKLYDFSS 59
                        8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.001161IPR002100Transcription factor, MADS-box
CDDcd002652.99E-37267No hitNo description
SuperFamilySSF554551.57E-29267IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MGRGKIEIRR IDNSTSRQVT FSKRRGGLLK KAKELAILCD AEVGVMIFSS TGKLYDFSST  60
STISKYRCY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-19161161MEF2C
5f28_B2e-19161161MEF2C
5f28_C2e-19161161MEF2C
5f28_D2e-19161161MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in leaves, moderate levels in roots, seedlings and stems, and at low levels in flowers, pollen and siliques. Accumulates in leaf guard cells and trichomes. Also present in epidermal cells of roots (PubMed:11115127, PubMed:12837945, PubMed:12949148). Expressed in mature guard cells (PubMed:17704216). {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:17704216}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G150700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024457843.12e-36MADS-box transcription factor 23 isoform X3
SwissprotA2RVQ53e-31AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A3N7F4H44e-35A0A3N7F4H4_POPTR; Uncharacterized protein
TrEMBLA0A3N7G9K23e-35A0A3N7G9K2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19440.18e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-33AGAMOUS-like 16
Publications ? help Back to Top
  1. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]