PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G149100.1
Common NamePOPTR_0005s19310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 343aa    MW: 37004.9 Da    PI: 8.628
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G149100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.8e-393292262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +e+alkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP Ggg+rknkk +
  Potri.005G149100.1 32 QEEALKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPFGGGCRKNKKIK 92
                        57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-263090IPR003851Zinc finger, Dof-type
PfamPF027016.0E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1613690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMAPDNLQAK QAPIDDNQIT TSNRKTTTTR PQEEALKCPR CDSPNTKFCY YNNYSLTQPR  60
HFCKTCRRYW TKGGALRNVP FGGGCRKNKK IKSSSGLSSD SSGSSEIGGF NFFHGLSPAM  120
KFNLGGLSFP RLNLSPNGIY NHFPSFGDIS ATSEAAATVT SPRFRLDPSV SSTAGSGSLM  180
GFSYPLTSVS SGFCGATQEN TGGASVNVNT NLASSIESLS CINQDLHWKL QQQRLAMLFG  240
TGKNHRDDST VSTAPIENHV QKLQPIMFEN LEISKPQVCA AGNSRKDGAT SGDPATEWFF  300
GNSYDQLTAT PTNRSNNGNN DNTGNWNGVQ AWGDLNQYSA LP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G149100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307317.10.0dof zinc finger protein DOF5.7
TrEMBLB9H6Q90.0B9H6Q9_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-61Dof family protein