PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G147100.2
Common NamePOPTR_0005s19080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 267aa    MW: 29839.9 Da    PI: 8.1465
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G147100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.1e-19122176256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++++++ +++e LA++l+L  rqV vWFqNrRa+ k
  Potri.005G147100.2 122 RKKLRLTKEQSALLEESFKQHSNLNPKQKEALARQLNLRPRQVEVWFQNRRARTK 176
                         788899***********************************************98 PP

2HD-ZIP_I/II124.55e-40122211191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk++++al++en+rL+ke +eL+ +l
  Potri.005G147100.2 122 RKKLRLTKEQSALLEESFKQHSNLNPKQKEALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCEALTDENRRLQKELQELK-AL 211
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-18111172IPR009057Homeodomain-like
SuperFamilySSF466893.51E-19112179IPR009057Homeodomain-like
PROSITE profilePS5007117.653118178IPR001356Homeobox domain
SMARTSM003892.3E-16120182IPR001356Homeobox domain
CDDcd000866.83E-18122179No hitNo description
PfamPF000462.2E-16122176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
SMARTSM003401.4E-25178221IPR003106Leucine zipper, homeobox-associated
PfamPF021832.2E-10178212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGCLDDGCST GLVLGLGLIP LTDLESTSKP DDYSNRLIRP QIKPSLKFDH KPLTSTSFEP  60
SLSLSIVAHD LLYRQASPDQ SAVSSFSSGR VKRERDLGCE DIEVERISSR VSDEDEDGTN  120
ARKKLRLTKE QSALLEESFK QHSNLNPKQK EALARQLNLR PRQVEVWFQN RRARTKLKQT  180
EVDCEFLKKC CEALTDENRR LQKELQELKA LKLAQPFYMH MPAATLTMCP SCERIGGGGD  240
GASKSSFSMV PKPHFYNTFT NPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170178RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.111680.0bud| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G147100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024457165.10.0homeobox-leucine zipper protein HAT22
SwissprotP466041e-99HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2K2AGX70.0A0A2K2AGX7_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-90HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]