PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G145600.1
Common NamePOPTR_0005s18920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 458aa    MW: 51665 Da    PI: 6.0477
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G145600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.21.6e-93534542373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsev 87 
                         ++lL++cA+a++s++++l q++++ l+++a pdgd++qRl++ f++AL ar ++  s ++k l++ +++++n   +++++++ +l  f++v
  Potri.005G145600.1  53 EQLLVHCANAIESNNATLSQQIVWVLNNIAPPDGDSNQRLTFAFLRALIARATK--SCTCKLLAAMANAHYNlalHTHKFSVIELasFVDV 141
                         79****************************************************..5566666666666666344555555655588**** PP

                GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvp 175
                         +P+++f++ +aN aIleaveg   +Hi+D+++++++Q p+L++a+a+R e pp +++T+ g+ e +      ++ee+g++L +fA + +v 
  Potri.005G145600.1 142 TPWHRFGFTAANAAILEAVEGYLVIHIVDLSLTHCMQIPTLIDAIANRFEVPPLIKLTVAGATEDVppmLDLSYEELGSKLVNFAWSRNVI 232
                         **************************************************************887798888999***************** PP

                GRAS 176 fefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll..................desvsleserdevLklvkslsPkvv 239
                         +ef+++   +a+ +++l +e+Lrv++      gEal++n++++lh+++                  ++  s++s r+++Lk ++sl P++v
  Potri.005G145600.1 233 MEFRIIpssYADGFSSL-IEQLRVQHlvhaesGEALVINCHMMLHYIPeetlsdfpssksnpysyeSSCSSMSSFRTTFLKSLRSLDPTIV 322
                         ******99855555555.55555555555558********************************96666777789**************** PP

                GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                         v+v+++ad++s+++  r+ +a++y +  fd++++ lpr s++r+++E+  + ++i+n++a+eg +r+er e + +W +r+++a F+ +++ 
  Potri.005G145600.1 323 VLVDEDADLTSNNLESRLRSAFNYLWIPFDTVDTFLPRGSKQRQWYEAD-VCWKIMNLIAHEGLQRVERLEPKIQWIQRMRNADFRGISFA 412
                         *************************************************.99*************************************** PP

                GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         e+a +++k++l +++  g+ +++e++ lvl+Wk++++v++SaW
  Potri.005G145600.1 413 EDAISEVKTMLDEHA-AGWGLKKEDDDLVLTWKGHNVVFASAW 454
                         ***************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.44526436IPR005202Transcription factor GRAS
PfamPF035145.4E-9153454IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MQSTETPLPH WHQIITPFSN PTMNINQTQR TRHWPGFPTS KSLRSFGDAN CMEQLLVHCA  60
NAIESNNATL SQQIVWVLNN IAPPDGDSNQ RLTFAFLRAL IARATKSCTC KLLAAMANAH  120
YNLALHTHKF SVIELASFVD VTPWHRFGFT AANAAILEAV EGYLVIHIVD LSLTHCMQIP  180
TLIDAIANRF EVPPLIKLTV AGATEDVPPM LDLSYEELGS KLVNFAWSRN VIMEFRIIPS  240
SYADGFSSLI EQLRVQHLVH AESGEALVIN CHMMLHYIPE ETLSDFPSSK SNPYSYESSC  300
SSMSSFRTTF LKSLRSLDPT IVVLVDEDAD LTSNNLESRL RSAFNYLWIP FDTVDTFLPR  360
GSKQRQWYEA DVCWKIMNLI AHEGLQRVER LEPKIQWIQR MRNADFRGIS FAEDAISEVK  420
TMLDEHAAGW GLKKEDDDLV LTWKGHNVVF ASAWLPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-464745782475Protein SHORT-ROOT
5b3h_B2e-464845729421Protein SHORT-ROOT
5b3h_E2e-464845729421Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G145600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306498.30.0scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A061DGZ90.0A0A061DGZ9_THECC; SCL domain class transcription factor
STRINGPOPTR_0005s18920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein