PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G134600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 364aa    MW: 40982.1 Da    PI: 7.0665
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G134600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32226281156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH++Fv+a++qLGG ++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Potri.005G134600.1 226 KQRRCWSPELHRCFVDALQQLGGYQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 281
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-18223284IPR009057Homeodomain-like
PROSITE profilePS5129413.892223283IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-30225284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26226281IPR006447Myb domain, plants
PfamPF002493.8E-7228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MELSLDLSLV YVPKAISECL KEVSMVKDGS QKLPNPDDYV KRLEDERRKI DAFKRELPLC  60
MLLLNEAIIR LKEEAMQCKE LNALVPLKGD SNEDGNDKKK WMSSVQLWNT NNNINLDCKN  120
QDTRSEPKQR GEEDDDRSTC ENPIQLGNHG NKGGAFVPFK ALSGFERSKK KEEKEVVSQV  180
TGLSLMTPVP KSCDFMSKSN NCGNQMKIQS KSQQQQQQQR QHAYRKQRRC WSPELHRCFV  240
DALQQLGGYQ VATPKQIREL MQVDGLTNDE VKSHLQKYRL HLRKVPASSA TPANDLWKSQ  300
DQCEDPVMHN ISESNSPKAP LHGSSSAKAA SNSGGDSMEA EDDDKSESHS WNGVLHHPGE  360
VHV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G134600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165992e-66AC216599.1 Populus trichocarpa clone POP051-K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456554.10.0transcription factor HHO5
TrEMBLA0A2K2AGB00.0A0A2K2AGB0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-67G2-like family protein