PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G134200.2
Common NamePOPTR_0005s14080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 270aa    MW: 28812.1 Da    PI: 9.7927
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G134200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-3952111362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk++s
  Potri.005G134200.2  52 QEKLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKNTS 111
                         7899*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2552108IPR003851Zinc finger, Dof-type
PfamPF027016.3E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54455109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MIQELLGGAG LISGERKIPI NATILDQGAP SPSPSSSTTT TTSATNSTPS AQEKLRCPRC  60
DSSNTKFCYY NNYNLTQPRH FCKTCRRYWT KGGALRNVPI GGGCRKNKNT SVSASVGKSG  120
TSKIKTIASE IGRSGFGNGF DYELSSSPIM RASPQNSHIF ALLRATQNPN PSTPCNSISV  180
KQEGFLIGKH MITQNSGIQE LYQRLRSSTN YYTDNPSAIV LSNVTTSSST STSTSSTILE  240
SAPVAGGEFS YWNQAFSWSG LPTTNGAYP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.131231e-165stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G134200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1447491e-162EF144749.1 Populus trichocarpa clone WS01117_M16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456610.11e-163dof zinc finger protein DOF2.4
TrEMBLA0A2K2AG931e-159A0A2K2AG93_POPTR; Uncharacterized protein
STRINGPOPTR_0005s14080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-35TARGET OF MONOPTEROS 6