PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G131600.1
Common NamePOPTR_0005s13990g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 254aa    MW: 25995.9 Da    PI: 8.5862
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G131600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.1e-383292262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ++++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Potri.005G131600.1 32 EQEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKNAKRS 92
                        68899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-282990IPR003851Zinc finger, Dof-type
PfamPF027013.1E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2553690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MPTELSSSEK TRRPPLSTTP TSNKPGGAPP QEQEHLPCPR CDSTNTKFCY YNNYNFSQPR  60
HFCKSCRRYW THGGTLRDIP VGGGTRKNAK RSRTSATTAA SFAGPIIDNN IDNLPLPATP  120
VLVPLTASQG FSVHFGGGSD GKGNGGCGSG ALGGSFTSLL NTPGPAGILA LGRFGHGLGH  180
GLEDVGCGLG RGLWSFPGIG DSGAGVGGHG GVTVTAGLDN TWQFGSAGQN GFVGGDCFSW  240
PELAISTPAN GFK*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed in the whole plant. {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:8718629}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G131600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). {ECO:0000269|PubMed:10758484}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306448.10.0dof zinc finger protein DOF3.4
SwissprotQ390882e-57DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLB9H6B80.0B9H6B8_POPTR; Uncharacterized protein
STRINGPOPTR_0005s13990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-36OBF binding protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]