PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G122500.1
Common NamePOPTR_0005s12420g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 340aa    MW: 37981.5 Da    PI: 9.2955
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G122500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.5e-32123177358
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                         ++rY+eClkNhAas+Ggh++DGCgEfmp  geegt++++kCaAC+CHR+FHRre +
  Potri.005G122500.1 123 SIRYRECLKNHAASMGGHVLDGCGEFMPG-GEEGTPETFKCAACECHRSFHRREID 177
                         689*************************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-29124176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.6E-29125176IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-20126182IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.067126175IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.6E-29264337IPR009057Homeodomain-like
SuperFamilySSF466892.98E-19267336IPR009057Homeodomain-like
PROSITE profilePS500718.746273337IPR001356Homeobox domain
TIGRFAMsTIGR015653.3E-28275332IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELRGQEKET VMPRSFNPPN NRDSSSRIPS APTRRDHRHT DTVLPHTLDL EHQSLYQQQQ  60
QQQKQLNPQH QACKPTRDLD LTPDPTQATT PVATTSATNT APTPSRSISR SPPPPPTSAS  120
SASIRYRECL KNHAASMGGH VLDGCGEFMP GGEEGTPETF KCAACECHRS FHRREIDGAP  180
QCVANSTCYK NSNGKRNILP FPQQLVTSHA PPQSASLHPH QRYHHGTLST YTTPIAPMMM  240
SFGGGGAAAE SSSEDLNMYQ SDLQGQSSAQ PLISKKRFRT RFSEEQKDKM MEFAEKLGWR  300
IQKQDEQEVQ QFCSQVGVKR KVFKVWMHNN KQSMKKKQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-232763331875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.120661e-115bud| catkin
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, stems, flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G122500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1487350.0EF148735.1 Populus trichocarpa x Populus deltoides clone WS0137_D14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383190.10.0zinc-finger homeodomain protein 6
RefseqXP_024457240.10.0zinc-finger homeodomain protein 6
RefseqXP_024457241.10.0zinc-finger homeodomain protein 6
RefseqXP_024457242.10.0zinc-finger homeodomain protein 6
RefseqXP_024457243.10.0zinc-finger homeodomain protein 6
RefseqXP_024457244.10.0zinc-finger homeodomain protein 6
SwissprotQ9ZPW75e-68ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLU5GHR20.0U5GHR2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s12420.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.16e-56homeobox protein 24