PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G117600.1
Common NamePOPTR_0005s11960g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 334aa    MW: 36840.4 Da    PI: 7.4778
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G117600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18249283135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg  kTp+WR gp+g+ktLCnaCG++y++ +l
  Potri.005G117600.1 249 CSHCGIQKTPQWRAGPNGSKTLCNACGVRYKSGRL 283
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.1E-879331IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.426243279IPR000679Zinc finger, GATA-type
SMARTSM004017.0E-17243297IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.76E-14244306No hitNo description
Gene3DG3DSA:3.30.50.102.2E-15247281IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.77E-14248296No hitNo description
PROSITE patternPS003440249274IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16249283IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MERVEGALKT SFRKEMAVKF SPQVLDDFWP VNVTNGMSSD DFSVDELLDF SNENGFIEDE  60
ENPCVVSVSH KQETLKEDKN NDRSPYFAVK EDFVSGPTSE LCVPTDDLAS LEWLSHFVED  120
SNSEYAAPFP AIVSPPEPEK ENFAEQEKSV LTEPCFKTPV PAKARSKRTR TGVRVWPLGS  180
PTLTESSTSS SSSTSSSSPS SPWLIHTKPL LNAEPLWFEK PVVKRMKKKP SFHAAASGGG  240
GGSHSSRRCS HCGIQKTPQW RAGPNGSKTL CNACGVRYKS GRLLPEYRPA CSPTFSKELH  300
SNHHRKVLEM RRKKEILGQT EPGLVQPVVP SCV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229VKRMKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006383142.10.0zinc finger family protein
SwissprotQ9FH572e-85GATA5_ARATH; GATA transcription factor 5
TrEMBLB9MXJ50.0B9MXJ5_POPTR; Zinc finger family protein
STRINGPOPTR_0005s11960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-77GATA transcription factor 5