PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G101800.2
Common NamePOPTR_0005s10480g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 200aa    MW: 22552.7 Da    PI: 5.8848
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G101800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.58.5e-2255115257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Potri.005G101800.2  55 RQRWTPTPVQLQILERIFDQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 115
                         89*****************99**************************************97 PP

2Wus_type_Homeobox102.82.4e-3354117265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPtp Q++iLe+++++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Potri.005G101800.2  54 ARQRWTPTPVQLQILERIFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 117
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1849120IPR009057Homeodomain-like
PROSITE profilePS5007115.17551116IPR001356Homeobox domain
SMARTSM003896.2E-1553120IPR001356Homeobox domain
SuperFamilySSF466895.99E-1954117IPR009057Homeodomain-like
PfamPF000461.3E-1955115IPR001356Homeobox domain
CDDcd000861.96E-1455117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MDWDNNQENH QDSHQNQREC RNGINGTNVN VNGGRLGNLY CDPLMASGGH KITARQRWTP  60
TPVQLQILER IFDQGNGTPS KQKIKEITSE LSQHGQISET NVYNWFQNRR ARSKRKQLVA  120
SSNNAESEVE TEVDSLNEKK KPEIFHAQQN PPRAEDLCFQ SPEISSELHF LGDDHLTGKM  180
GVPGNYNLYD QAEDYGMAG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108116RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.161050.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G101800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827120.0KF982712.1 Populus tomentosa WOX13a (WOX13a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306432.11e-135WUSCHEL-related homeobox 13 isoform X2
RefseqXP_011022183.11e-135PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817881e-75WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLB9H6761e-133B9H676_POPTR; WOX family protein
STRINGPOPTR_0005s10480.11e-134(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-73WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]