PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G101800.1
Common NamePOPTR_0005s10480g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 249aa    MW: 27989 Da    PI: 5.5937
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G101800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-21104164257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Potri.005G101800.1 104 RQRWTPTPVQLQILERIFDQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 164
                         89*****************99**************************************97 PP

2Wus_type_Homeobox102.23.6e-33103166265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPtp Q++iLe+++++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Potri.005G101800.1 103 ARQRWTPTPVQLQILERIFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 166
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-1898169IPR009057Homeodomain-like
PROSITE profilePS5007115.175100165IPR001356Homeobox domain
SMARTSM003896.2E-15102169IPR001356Homeobox domain
SuperFamilySSF466898.98E-19103166IPR009057Homeodomain-like
PfamPF000462.0E-19104164IPR001356Homeobox domain
CDDcd000864.10E-14104166No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDWDNNQENH QDSHQNQREC RNGINGTNVN VNGNGGTNML YVKVMTDEQL ETLRKQIAVY  60
AAICEQLVEM HKTLSAQQDL AGGRLGNLYC DPLMASGGHK ITARQRWTPT PVQLQILERI  120
FDQGNGTPSK QKIKEITSEL SQHGQISETN VYNWFQNRRA RSKRKQLVAS SNNAESEVET  180
EVDSLNEKKK PEIFHAQQNP PRAEDLCFQS PEISSELHFL GDDHLTGKMG VPGNYNLYDQ  240
AEDYGMAG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157165RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.161050.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G101800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827120.0KF982712.1 Populus tomentosa WOX13a (WOX13a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306432.10.0WUSCHEL-related homeobox 13 isoform X2
RefseqXP_011022183.10.0PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817881e-105WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLB9H6760.0B9H676_POPTR; WOX family protein
STRINGPOPTR_0005s10480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Representative plantOGRP18731639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-106WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]