PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G101000.1
Common NamePOPTR_0005s10400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 353aa    MW: 40569.5 Da    PI: 10.3023
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G101000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.48.1e-25230279352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++i led+ k+F lpi +A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  Potri.005G101000.1 230 ARIALEDVVKCFGLPIVEASRNLKVGLTVLKRKCRELGIPRWPHRKIKSL 279
                         6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.11214299IPR003035RWP-RK domain
PfamPF020421.1E-19232279IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MASSLIALLV FENNINKEFP ACISVIVDSF FDRVTIPIRG WFLVHIGPIL RLRRFQVLEL  60
FEGQVIGLWR CIFAFHVNNP PHLSHSSFLL SVSRSAFIII VVEKAHMKLH SPTCLRSLFP  120
VWQGNMRQLM RRNPKLKSIP TLAKDIHFIL KLSCKTDNEE PSRFSSKEIC EVDRDNCHQS  180
KKSLPVLDQD LNCLPNSVSP SELSKSEQIE LCAAGVMEKK KKRAASEDIA RIALEDVVKC  240
FGLPIVEASR NLKVGLTVLK RKCRELGIPR WPHRKIKSLD SLICSLQEEA ERHKQDNEDT  300
TMAVAKRRRM LEREKETIEK KPFMEIQSET KRFRQDVFKR RHRARALGNQ GL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G101000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456810.10.0protein RKD5 isoform X1
TrEMBLA0A2K2AEL00.0A0A2K2AEL0_POPTR; Uncharacterized protein
STRINGPOPTR_0005s10400.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-74RWP-RK domain-containing protein