PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G075100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CAMTA
Protein Properties Length: 1117aa    MW: 126102 Da    PI: 5.6108
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G075100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1177.12.3e-55201362118
                CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenp 92 
                         ++ ++rwl++ ei++iL n+++++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+e+n+
  Potri.005G075100.1  20 VEAQNRWLRPAEIVEILSNYQRFRIAPEPAHMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKSGSVDVLHCYYAHGEDNE 110
                         6679*************************************************************************************** PP

                CG-1  93 tfqrrcywlLeeelekivlvhylevk 118
                         +fqrr+yw+Leeel++ivlvhy+evk
  Potri.005G075100.1 111 NFQRRSYWMLEEELSHIVLVHYREVK 136
                         ***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.37415141IPR005559CG-1 DNA-binding domain
SMARTSM010762.1E-7518136IPR005559CG-1 DNA-binding domain
PfamPF038591.2E-4821134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.109.5E-5534621IPR013783Immunoglobulin-like fold
SuperFamilySSF812962.49E-15535621IPR014756Immunoglobulin E-set
PfamPF018331.4E-5535618IPR002909IPT domain
PROSITE profilePS5029719.041706839IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.5E-17715831IPR020683Ankyrin repeat-containing domain
CDDcd002041.00E-12716827No hitNo description
SuperFamilySSF484032.95E-16722829IPR020683Ankyrin repeat-containing domain
PfamPF127964.8E-7740830IPR020683Ankyrin repeat-containing domain
SMARTSM002480.011768797IPR002110Ankyrin repeat
PROSITE profilePS500889.778768800IPR002110Ankyrin repeat
SMARTSM00248930807836IPR002110Ankyrin repeat
SuperFamilySSF525401.14E-7938992IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000152941963IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.206944971IPR000048IQ motif, EF-hand binding site
PfamPF006120.0047944962IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039964986IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.597965989IPR000048IQ motif, EF-hand binding site
PfamPF006122.3E-4967986IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0001077Molecular Functiontranscriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1117 aa     Download sequence    Send to blast
MADSRRYPLG NQLDIQQILV EAQNRWLRPA EIVEILSNYQ RFRIAPEPAH MPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKSGSVDVLH CYYAHGEDNE NFQRRSYWML  120
EEELSHIVLV HYREVKGTRT NFNRIKEYEE PIPYSQETKD MMPNSEMDTS VSSSFRSNGY  180
QVPTGTTDST SMNSALASEY EDAESGYNNQ ASSRFNSFLE VQRPAMEKMD TGTSIPYDHM  240
LFSSGYQGKM PAVPVMEFIS PAQVDTAKDT IGTEPASEPQ KVFDLPSWED VLENCSRGIE  300
SVPFQTTLLS QVDTVGVIPK QEDILEKFLA NSFDKRQGMV GVIPKQEDIL EKFLTNSFDR  360
SQDIGSHLLD QEAWQTIEGG YSHRPKWSLD QKLHLDSDLT ARFHDQQLDS GNFINTFEPF  420
CAQENDNHIQ NDLQIQPANS DHGMTLDEKS IYSTSMKQHI LDDSRTEGLK KLDSFTRWMS  480
KELEDVDQPH LQSSSGTYWI SAESENVVDA DNPSHGHLDT YTLGPSLSQD QLFSIIDFSP  540
NWAYAGTEIK ILVMGRFLKS REEAENFKWS IMFGEVEVPA ETIADGILRC TTPSHKAGRV  600
PFYVTCSNRV ACSEVREFEY RLSHVQDITY NYINIATEDL HMRLAKLLSL SSAFPSKYDS  660
SDVDEISQLS NKISSLLKEG NETWDQMLKL TSLEGFSSEK LKDQLLQKAL KEQLHEWLLQ  720
KVAEGGKGPS VLDEGGQGVL HFAAALGYEW ALEPTIVAGV SVNFRDVNGW TALHWAASYG  780
RERTVASLIH LGAAPGALTD PTPKYPTGRT PADLASANGH KGISGFLAES ALSAHLSSLN  840
LEKQDGDAAE SSGIPASLTV SDCNETPVKD ADIPIGLSLK DSLAAVCNAT QAAARIHQVF  900
RVQSFQKKQL KEYGDDKFGM SHERALSLIA VKSQKAGQYD EPVHAAIRIQ NKFRGWKGRK  960
EFLIIRQRIV KIQAHVRGHQ VRKNYRKIIW SVGILDKIIL RWRRKGSGLR GFKSEALTEG  1020
SSMQVVSTKD DDDDFLKEGR KQTEERSQIA LARVKSMHQH PEAREQYHRL RNVVAEIQET  1080
KAMYEWANNS EAMVEFDDLI NLETLWDGDT FLPTDS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, carpels, and siliques, but not in stigmas or other parts of the flower. {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:14581622}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'. Binds calmodulin in a calcium-dependent manner in vitro (PubMed:12218065). Regulates transcriptional activity in response to calcium signals (Probable). Involved in freezing tolerance in association with CAMTA1 and CAMTA2 (PubMed:23581962). Required for the cold-induced expression of DREB1B/CBF1, DREB1C/CBF2, ZAT12 and GOLS3 (PubMed:19270186). Involved in response to cold. Contributes together with CAMTA5 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:28351986). Involved together with CAMTA2 and CAMTA4 in the positive regulation of a general stress response (GSR) (PubMed:25039701). Involved in the regulation of GSR amplitude downstream of MEKK1 (PubMed:25157030). Involved in the regulation of a set of genes involved in defense responses against pathogens (PubMed:18298954). Involved in the regulation of both basal resistance and systemic acquired resistance (SAR) (PubMed:21900483). Acts as negative regulator of plant immunity (PubMed:19122675, PubMed:21900483, PubMed:22345509, PubMed:28407487). Binds to the promoter of the defense-related gene EDS1 and represses its expression (PubMed:19122675). Binds to the promoter of the defense-related gene NDR1 and represses its expression (PubMed:22345509). Involved in defense against insects (PubMed:23072934, PubMed:22371088). Required for tolerance to the generalist herbivore Trichoplusia ni, and contributes to the positive regulation of genes associated with glucosinolate metabolism (PubMed:23072934). Required for tolerance to Bradysia impatiens larvae. Mediates herbivore-induced wound response (PubMed:22371088). Required for wound-induced jasmonate accumulation (PubMed:23072934, PubMed:22371088). Involved in the regulation of ethylene-induced senescence by binding to the promoter of the senescence-inducer gene EIN3 and repressing its expression (PubMed:22345509). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:18298954, ECO:0000269|PubMed:19122675, ECO:0000269|PubMed:19270186, ECO:0000269|PubMed:21900483, ECO:0000269|PubMed:22345509, ECO:0000269|PubMed:22371088, ECO:0000269|PubMed:23072934, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25157030, ECO:0000269|PubMed:28351986, ECO:0000269|PubMed:28407487, ECO:0000305|PubMed:11925432}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G075100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat shock, UVB, salt, wounding, ethylene and methyl jasmonate (PubMed:11162426, PubMed:12218065). Induced by infection with the fungal pathogen Golovinomyces cichoracearum (powdery mildew) and the bacterial pathogen Pseudomonas syringae pv tomato strain DC3000 (PubMed:22345509). {ECO:0000269|PubMed:11162426, ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:22345509}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456348.10.0calmodulin-binding transcription activator 3 isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A2K2AD130.0A0A2K2AD13_POPTR; Uncharacterized protein
STRINGPOPTR_0007s05410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Representative plantOGRP5621565
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1
Publications ? help Back to Top
  1. Zhang L,Du L,Shen C,Yang Y,Poovaiah BW
    Regulation of plant immunity through ubiquitin-mediated modulation of Ca(2+) -calmodulin-AtSR1/CAMTA3 signaling.
    Plant J., 2014. 78(2): p. 269-81
    [PMID:24528504]
  2. Benn G, et al.
    A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.
    Plant J., 2014. 80(1): p. 82-92
    [PMID:25039701]
  3. Rahman H,Yang J,Xu YP,Munyampundu JP,Cai XZ
    Phylogeny of Plant CAMTAs and Role of AtCAMTAs in Nonhost Resistance to Xanthomonas oryzae pv. oryzae.
    Front Plant Sci, 2016. 7: p. 177
    [PMID:26973658]
  4. Benn G, et al.
    Plastidial metabolite MEcPP induces a transcriptionally centered stress-response hub via the transcription factor CAMTA3.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(31): p. 8855-60
    [PMID:27432993]
  5. Kidokoro S, et al.
    Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.
    Plant Cell, 2017. 29(4): p. 760-774
    [PMID:28351986]
  6. Lolle S, et al.
    Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.
    Cell Host Microbe, 2017. 21(4): p. 518-529.e4
    [PMID:28407487]
  7. Kim YS, et al.
    CAMTA-Mediated Regulation of Salicylic Acid Immunity Pathway Genes in Arabidopsis Exposed to Low Temperature and Pathogen Infection.
    Plant Cell, 2017. 29(10): p. 2465-2477
    [PMID:28982964]
  8. Jacob F, et al.
    A dominant-interfering camta3 mutation compromises primary transcriptional outputs mediated by both cell surface and intracellular immune receptors in Arabidopsis thaliana.
    New Phytol., 2018. 217(4): p. 1667-1680
    [PMID:29226970]