PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G071900.4
Common NamePOPTR_0005s07290g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 291aa    MW: 32662 Da    PI: 4.3986
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G071900.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-192174356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Potri.005G071900.4 21 KKRRLSGDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 74
                        566899***********************************************9 PP

2HD-ZIP_I/II130.56.8e-4220112193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy +Lk++yd+lk++ +++++++e+L +e+
  Potri.005G071900.4  20 EKKRRLSGDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDSLKHNFDAIQQDNEALLKEI 110
                         69*************************************************************************************9999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Potri.005G071900.4 111 RE 112
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-191478IPR009057Homeodomain-like
PROSITE profilePS5007117.4911676IPR001356Homeobox domain
SMARTSM003897.4E-181980IPR001356Homeobox domain
CDDcd000861.39E-162177No hitNo description
PfamPF000461.8E-162174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-202383IPR009057Homeodomain-like
PRINTSPR000317.7E-64756IPR000047Helix-turn-helix motif
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
PRINTSPR000317.7E-65672IPR000047Helix-turn-helix motif
PfamPF021835.3E-1976117IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MLNGLDEEGC VEESGGHVTE KKRRLSGDQV KALEKNFEVE NKLEPERKVK LAQELGLQPR  60
QVAVWFQNRR ARWKTKQLER DYGVLKANYD SLKHNFDAIQ QDNEALLKEI RELKAKLNEE  120
NTESNVSVKE EIILAESEDK VTEEDTPPLL DSLTASAEAK ELNYENFNSS SSINNGLGAS  180
LFPDFKDGLS DSDSSAILNE DNSPNPAISS SGILQSQLMM SPPPSSSLKF NCSTSSSSPS  240
TMNSFQFSKT YQTQFVKLEE HNFLSSEEAC NFFSDEQPPT LHWYCSDQWN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16876RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.95920.0bud| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed with a lower level in siliques. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development. {ECO:0000269|PubMed:14623244}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G071900.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1479450.0EF147945.1 Populus trichocarpa clone WS0126_C14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306291.20.0homeobox-leucine zipper protein ATHB-6 isoform X1
RefseqXP_024457294.10.0homeobox-leucine zipper protein ATHB-6 isoform X2
SwissprotQ940J16e-75ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A2K2ACU40.0A0A2K2ACU4_POPTR; Uncharacterized protein
TrEMBLA0A2K2ACW60.0A0A2K2ACW6_POPTR; Uncharacterized protein
TrEMBLB9H4Q50.0B9H4Q5_POPTR; HD-ZIP family protein
STRINGPOPTR_0005s07290.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-73homeobox protein 16
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]