PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.005G023700.1
Common NamePOPTR_0005s02350g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 485aa    MW: 54628.3 Da    PI: 7.7241
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.005G023700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR154.92.8e-1758142289
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                         + ++YAk +GF+ r ++s+k+k nge    ++vC+keg+++++ k+    +  r + r gC+  +  ++++dg+w+++k++l+H He+
  Potri.005G023700.1  58 YLQSYAKAIGFQWRYRTSRKNKSNGERCGVRMVCTKEGTNKPRGKS---PKYFRLSGREGCNVAMSSSLQSDGRWKISKIHLQHCHEI 142
                         5689***************************************999...88999********************************97 PP

2FAR132.52.7e-10195272290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         f  +YAk+vGF+ ++++s+k k++g++    +vCsk+ +r++ ++           +  gC+ +l  +++kdg+w+++k++l H He+ 
  Potri.005G023700.1 195 FLFSYAKKVGFQWSIRTSRKDKNSGKTCGICMVCSKSKRRKQPNS-----------EGEGCDVSLCSTLQKDGQWKINKIHLRHCHEMD 272
                         6668*******************************9877666544...........589****************************96 PP

3FAR147.65.5e-15350427390
                FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          ++YAk vGF+ rk++s+k++++gei   ++vC+kegkr +             + + gC   ++ +++k g+w+++k++leH+He+ 
  Potri.005G023700.1 350 LCSYAKAVGFEWRKRTSRKNENSGEICGVRMVCNKEGKRGSLGP----------SMKKGCPVAVNSTLQKGGRWRINKINLEHSHEID 427
                         579************************************99765..........5999***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.6E-1458142IPR004330FAR1 DNA binding domain
PfamPF031014.8E-7195272IPR004330FAR1 DNA binding domain
PfamPF031012.9E-11349427IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MDELLRLSIG GAANSDVNIS GGEAAGPTSL PADGVDRNLL QPPYDGQTFG SLEEMVQYLQ  60
SYAKAIGFQW RYRTSRKNKS NGERCGVRMV CTKEGTNKPR GKSPKYFRLS GREGCNVAMS  120
SSLQSDGRWK ISKIHLQHCH EIDLNAVPLH MRQHLLELND RSGIEEEEEE ENEEEEEGKP  180
YDGQTFGSYA ELIQFLFSYA KKVGFQWSIR TSRKDKNSGK TCGICMVCSK SKRRKQPNSE  240
GEGCDVSLCS TLQKDGQWKI NKIHLRHCHE MDPNATPILR RWYLLALNGR MGIEEEEAKE  300
EGEEMEEGEG ETEQEEAGNS SLSNDIDRPS IDPLYNGQTF GSLQELIQYL CSYAKAVGFE  360
WRKRTSRKNE NSGEICGVRM VCNKEGKRGS LGPSMKKGCP VAVNSTLQKG GRWRINKINL  420
EHSHEIDPNV RPFLRRRHRS IPPQLRDPLV SNDRLGIEDE EERGRGGGRR SCTCCLGATS  480
RLKW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.97170.0bud| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.005G023700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024456282.10.0protein FAR1-RELATED SEQUENCE 12
TrEMBLA0A2K2AAK50.0A0A2K2AAK5_POPTR; Uncharacterized protein
STRINGPOPTR_0005s02350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2311534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.12e-15FAR1-related sequence 7