PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G230100.2
Common NamePOPTR_0004s23920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family B3
Protein Properties Length: 416aa    MW: 46957.8 Da    PI: 9.4829
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G230100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.72.1e-131761799
                        E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                        +lp kf++++g++   +   +     g+ We++l  ++++g+++l+kGWkeF++   +  g f+vF+++++ +f  +v +f++
  Potri.004G230100.2  1 MLPQKFVTRYGMD--LTNLAR-LKVLGEAWEIEL--KRCDGKVWLQKGWKEFAEYYSVACGHFLVFEYERNCDF--HVLIFDN 76
                        69********988..433444.44579*******..*********************************99***..****997 PP

2B371.79.2e-23241335198
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         f+ +++ps+v++   l++p +fa+++  k++++  +tl  ++gr+W vk++ +++++++++  GWk F+k+n+L +gDf+vF+l++ +e +
  Potri.004G230100.2 241 FKVAMSPSYVHTGYKLSVPSSFARKYFTKNKGN--VTLCVTDGRTWPVKYC-NRTKSGVIFCHGWKAFAKDNKLAVGDFCVFELINVTEMS 328
                         667899********************6555554..7777777********5.55556688999*********************9988888 PP

                         .EEEEE- CS
                  B3  92 lvvkvfr 98 
                         l+v +fr
  Potri.004G230100.2 329 LKVVFFR 335
                         8888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.89E-16177IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.098177IPR003340B3 DNA binding domain
SMARTSM010190.0022177IPR003340B3 DNA binding domain
CDDcd100176.14E-11175No hitNo description
Gene3DG3DSA:2.40.330.102.8E-17277IPR015300DNA-binding pseudobarrel domain
PfamPF023621.8E-10276IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-28233335IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-26234335IPR015300DNA-binding pseudobarrel domain
CDDcd100178.29E-28239335No hitNo description
SMARTSM010191.6E-20241337IPR003340B3 DNA binding domain
PfamPF023627.8E-21241335IPR003340B3 DNA binding domain
PROSITE profilePS5086314.734241337IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MLPQKFVTRY GMDLTNLARL KVLGEAWEIE LKRCDGKVWL QKGWKEFAEY YSVACGHFLV  60
FEYERNCDFH VLIFDNSATE IDYPLKNNRS EVPGRGLLKE CTKDRGKENN SVEILDHFSP  120
SRRTRKKSPL PCPRPHKMVR TYSTYETGTC SKLSTSVEVP PTGTWSRGMK LESSKTKAKL  180
RCSVRGLDEE DSIRGGRGML MARGQRLSYA GALANMRSLT CYEKAKALCR TSAFKSENPF  240
FKVAMSPSYV HTGYKLSVPS SFARKYFTKN KGNVTLCVTD GRTWPVKYCN RTKSGVIFCH  300
GWKAFAKDNK LAVGDFCVFE LINVTEMSLK VVFFRLKDVE SLLSSDMGGA NQVEPNKSLV  360
AKPQSDWNSR DGAGISNPDD EHKPGEFEHS ESRFEVEPGK LGISLLKTKL MQEEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A5e-2020933817144B3 domain-containing transcription factor VRN1
4i1k_B5e-2020933817144B3 domain-containing transcription factor VRN1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121127RRTRKKS
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G230100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024454888.10.0B3 domain-containing transcription factor VRN1 isoform X2
TrEMBLA0A2K2AZ180.0A0A2K2AZ18_POPTR; Uncharacterized protein
STRINGPOPTR_0004s23920.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-42B3 family protein