PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G230100.1
Common NamePOPTR_0004s23920g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family B3
Protein Properties Length: 559aa    MW: 63455.1 Da    PI: 9.9716
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G230100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.63.4e-1619108299
                         EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                  B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                         fkv   +d+l++g l+lp kf++++g++   +   +     g+ We++l  ++++g+++l+kGWkeF++   +  g f+vF+++++ +f  
  Potri.004G230100.1  19 FKVI-LEDSLREGKLMLPQKFVTRYGMD--LTNLAR-LKVLGEAWEIEL--KRCDGKVWLQKGWKEFAEYYSVACGHFLVFEYERNCDF-- 101
                         5544.589999999***********988..433444.44579*******..*********************************99***.. PP

                         EEEEE-S CS
                  B3  93 vvkvfrk 99 
                         +v +f++
  Potri.004G230100.1 102 HVLIFDN 108
                         ****997 PP

2B3711.5e-22273367198
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         f+ +++ps+v++   l++p +fa+++  k++++  +tl  ++gr+W vk++ +++++++++  GWk F+k+n+L +gDf+vF+l++ +e +
  Potri.004G230100.1 273 FKVAMSPSYVHTGYKLSVPSSFARKYFTKNKGN--VTLCVTDGRTWPVKYC-NRTKSGVIFCHGWKAFAKDNKLAVGDFCVFELINVTEMS 360
                         667899********************6555554..7777777********5.55556688999*********************9988888 PP

                         .EEEEE- CS
                  B3  92 lvvkvfr 98 
                         l+v +fr
  Potri.004G230100.1 361 LKVVFFR 367
                         8888887 PP

3B361.91.1e-19463555198
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         ffkv ++s++l+++ +++p +f+e++ + k    ++++ +   rsW vkli+r ++++ +l++GW +F+++n L++g ++ F+ ++  ++ 
  Potri.004G230100.1 463 FFKVVLRSYYLNRCFVSVPMSFVERYFKHKS---QIVMLQVADRSWPVKLIIRWSQRQAILSAGWARFARENSLQVGHVCAFEIVK--NGM 548
                         99************************75543...5999999*********9999999999***********************765..666 PP

                         .EEEEE- CS
                  B3  92 lvvkvfr 98 
                         l+v++ r
  Potri.004G230100.1 549 LKVSISR 555
                         7888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-2213109IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-2114109IPR015300DNA-binding pseudobarrel domain
CDDcd100174.62E-1516107No hitNo description
PROSITE profilePS5086312.36517109IPR003340B3 DNA binding domain
SMARTSM010192.7E-1518109IPR003340B3 DNA binding domain
PfamPF023624.3E-1318108IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-28265366IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-26266367IPR015300DNA-binding pseudobarrel domain
CDDcd100172.49E-26271367No hitNo description
SMARTSM010191.6E-20273369IPR003340B3 DNA binding domain
PfamPF023621.3E-20273367IPR003340B3 DNA binding domain
PROSITE profilePS5086314.734273369IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-23459556IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-21460556IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.1E-18463557IPR003340B3 DNA binding domain
CDDcd100171.24E-19463555No hitNo description
PROSITE profilePS5086314.24463557IPR003340B3 DNA binding domain
PfamPF023621.0E-17463555IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MGEGDGKPLM FVAKPPHFFK VILEDSLREG KLMLPQKFVT RYGMDLTNLA RLKVLGEAWE  60
IELKRCDGKV WLQKGWKEFA EYYSVACGHF LVFEYERNCD FHVLIFDNSA TEIDYPLKNN  120
RSEVPGRGLL KECTKDRGKE NNSVEILDHF SPSRRTRKKS PLPCPRPHKM VRTYSTYETG  180
TCSKLSTSVE VPPTGTWSRG MKLESSKTKA KLRCSVRGLD EEDSIRGGRG MLMARGQRLS  240
YAGALANMRS LTCYEKAKAL CRTSAFKSEN PFFKVAMSPS YVHTGYKLSV PSSFARKYFT  300
KNKGNVTLCV TDGRTWPVKY CNRTKSGVIF CHGWKAFAKD NKLAVGDFCV FELINVTEMS  360
LKVVFFRLKD VESLLSSEDM GGANQVEPNK SLVAKPQSDW NSRDGAGISN PDDEHKPGEF  420
EHSESRFEVE PDKFGKPELK NSSSVLVTRG SKTESKFIST HPFFKVVLRS YYLNRCFVSV  480
PMSFVERYFK HKSQIVMLQV ADRSWPVKLI IRWSQRQAIL SAGWARFARE NSLQVGHVCA  540
FEIVKNGMLK VSISRSDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A8e-2024155717144B3 domain-containing transcription factor VRN1
4i1k_B8e-2024155717144B3 domain-containing transcription factor VRN1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153159RRTRKKS
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G230100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385100.10.0B3 domain-containing transcription factor VRN1 isoform X1
TrEMBLB9N0J60.0B9N0J6_POPTR; Uncharacterized protein
STRINGPOPTR_0004s23920.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-46B3 family protein