PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G229600.1
Common NamePOPTR_0004s23860g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 272aa    MW: 30061.8 Da    PI: 8.2655
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G229600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.43.1e-3275132260
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         + vrY+eClkNhAas+Gg+a+DGCgEfmps geeg+++al+C+AC+CHRnFHR+e e e
  Potri.004G229600.1  75 KMVRYRECLKNHAASMGGNATDGCGEFMPS-GEEGSIEALTCSACNCHRNFHRKEIEGE 132
                         679**************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.3E-2977129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2677132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-3178129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.47179128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.605.4E-30191260IPR009057Homeodomain-like
SuperFamilySSF466897.59E-19196259IPR009057Homeodomain-like
TIGRFAMsTIGR015657.5E-27198254IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MELSSHEAGI PIPLNSTFGG AHGHGHGHLI HHDHPAVPHN HNNIISSTAP QIPSSNNGTS  60
ITTASIDDNH VPYKKMVRYR ECLKNHAASM GGNATDGCGE FMPSGEEGSI EALTCSACNC  120
HRNFHRKEIE GEHTSCTGDH CYHNSPVHFN RLGRKVILAS APHHQMIMSY NMGSLPSESD  180
EQEDGGGVLM ARPAQLMKKR FRTKFSQEQK EKMLNFAEKV GWKLQKQEET VVQQFCQEIG  240
VKRRVLKVWM HNNKHSLAKK NPSTTTTTSN S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-231992561875ZF-HD homeobox family protein
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Not detected in the meristem prior to exposure to long days (LDs), but after exposure to three LDs, stable accumulation on the flanks of the meristem adjacent to floral primordia, during floral induction. {ECO:0000269|PubMed:22319055}.
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Probably involved in the regulation of floral induction. {ECO:0000269|PubMed:22319055}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G229600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by exposure to long days. {ECO:0000269|PubMed:22319055}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164101e-125AC216410.1 Populus trichocarpa clone POP030-A06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455448.11e-179zinc-finger homeodomain protein 4
SwissprotQ9M9S02e-82ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A2K2AZ041e-177A0A2K2AZ04_POPTR; Uncharacterized protein
STRINGPOPTR_0004s23860.11e-178(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-82homeobox protein 31