PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G228800.5
Common NamePOPTR_0004s23770g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 546aa    MW: 60622.3 Da    PI: 7.1672
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G228800.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.21.3e-22128228198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F  
  Potri.004G228800.5 128 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL- 215
                         99****************************964333..4459************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          + +++el+v+v+r
  Potri.004G228800.5 216 -RGENGELRVGVRR 228
                         .449999*****97 PP

2Auxin_resp107.81.1e-35254336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++t++ F+v+Y+Pr+s+seF+v+++k+++  ++k+svGmRfkm+fe+e+++err+sGt+vgv d  ++ W +S WrsLk
  Potri.004G228800.5 254 ASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEVRNHKLSVGMRFKMRFEGEEVPERRFSGTIVGVGDNISSGWADSDWRSLK 336
                         789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.19E-44118257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-41125243IPR015300DNA-binding pseudobarrel domain
CDDcd100174.32E-21126228No hitNo description
SMARTSM010191.0E-21128230IPR003340B3 DNA binding domain
PfamPF023621.9E-20128228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.279128230IPR003340B3 DNA binding domain
PfamPF065079.5E-34254336IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MAFAAMNHTS GGNPHAGGCN DALYKELWHA CAGPLVTLPR EGELVYYFPQ GHMEQLEASM  60
HQGMEPQMPL FNLPSKILCK VVNVQRRAEP ETDEVYAQIT LLPEPDQSEV TSPDPPLPEP  120
ERCTVHSFCK TLTASDTSTH GGFSVLRRHA DDCLPPLDMS QQPPWQELVA TDLHGNEWHF  180
RHIFRGQPRR HLLTTGWSVF VSSKKLVAGD AFIFLRGENG ELRVGVRRLM RQQTNMPSSV  240
ISSQSMHLGV LATASHAIAT GTLFSVFYKP RTSRSEFIVS LNKYLEVRNH KLSVGMRFKM  300
RFEGEEVPER RFSGTIVGVG DNISSGWADS DWRSLKVQWD EPSSIMRPER VSHWELEPLV  360
ATTPSNSQPV QRNKRARPYV IPSPTADLSA LGMWKSPVES SALSYGDSQR GRDLYSSPNF  420
STTAKVNSLG FRGNSQVASV SHNSMHWPNR VESVTDSFAP VVNKDSGERR QGTGIGYKLF  480
GIQLVENSNT EGTSPVVVSG TVVNDLPVLS LEAESDQHSE PEKSCLRSSQ ELQSRQIRSC  540
TKQIL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.033591355Auxin response factor 1
4ldw_A0.033591355Auxin response factor 1
4ldw_B0.033591355Auxin response factor 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the sepals and carpels of young flower buds. At stage 10 of flower development, expression in the carpels becomes restricted to the style. Also expressed in anthers and filaments. At stage 13, expressed in the region at the top of the pedicel, including the abscission zone. {ECO:0000269|PubMed:16176952}.
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Acts as repressor of IAA2, IAA3 and IAA7. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:16176952}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G228800.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM1130350.0KM113035.1 Populus davidiana x Populus alba var. pyramidalis auxin response factor 1 family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385087.10.0auxin response factor 1 isoform X1
RefseqXP_024455395.10.0auxin response factor 1 isoform X1
RefseqXP_024455396.10.0auxin response factor 1 isoform X1
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLA0A2K2AYY60.0A0A2K2AYY6_POPTR; Auxin response factor
STRINGPOPTR_0004s23770.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Montesinos JC,Pastor-Cantizano N,Robinson DG,Marcote MJ,Aniento F
    Arabidopsis p24δ5 and p24δ9 facilitate Coat Protein I-dependent transport of the K/HDEL receptor ERD2 from the Golgi to the endoplasmic reticulum.
    Plant J., 2014. 80(6): p. 1014-30
    [PMID:25312353]
  2. Marais C, et al.
    The Qb-SNARE Memb11 interacts specifically with Arf1 in the Golgi apparatus of Arabidopsis thaliana.
    J. Exp. Bot., 2015. 66(21): p. 6665-78
    [PMID:26208648]
  3. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  4. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]