PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G153300.3
Common NamePOPTR_0004s16070g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 678aa    MW: 72669.4 Da    PI: 4.3373
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G153300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-112061245
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        g+WT +E +ll++a +++  + W+ Ia+++  ++t  qc++++ 
  Potri.004G153300.3 20 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFV 61
                        89*****************88.*********.**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-81660IPR009057Homeodomain-like
SuperFamilySSF466899.72E-131771IPR009057Homeodomain-like
PROSITE profilePS5129322.2021768IPR017884SANT domain
SMARTSM007172.7E-121866IPR001005SANT/Myb domain
PfamPF002492.1E-112062IPR001005SANT/Myb domain
CDDcd001670.001273863No hitNo description
PfamPF164955.5E-26522599IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MSSSDFILME PAEAAGVSGG KWTDQETLLL LEALELYKEN WNEIAEHVAT KTKAQCILHF  60
VQMPIEDAFF DCANDMDGTS KETADADATI EDTSAPKDVH DTSESKTGAD EDQHLTVPME  120
ASKPEDTSGV KVCQGGDVIN GQETSKSEDV SGVKAGEEIG ENVALRALTE AFEAVGYSPT  180
PENRLSFSEV GNPVMAVASF LARLVGPDVA TASACSALKS LSSNSPGMQL ASRHCFLLED  240
PPDERKKPSC SDCVATEMAD QDALKDKQEG KSQKGNSPTS GIDNKDLSDD YSDKKVEDSI  300
PEEKKPLDSS KGEFPDKVDV VNGGEMVVTH EEVEPGRSKE SSNSELPKDH TPSVVKESDE  360
IPPKSGCPPS SGKEPLEVTS AEEHSQLTEV AKDVDMVSNL KPPEKNGHSQ SFASMSVDEP  420
SQAVDVSKDV DMVSDSLPAD NNGSQQPVKS NATGEQSQTT EATADVDMSS SQPSEVNEPS  480
DPKVESGATA DEVPKDSKKE KPDSEVIKDD NNIDKLKRAA VSALSAAAVK AKLLANQEED  540
QIRELAASLI EKQLHKLETK LAFFNEMDSV IMRVREQLDR SRQRLYQERA QIIAARLGLP  600
PSSRAMPQSL PSNRIAMNFA NTFPRPPMNM ATQRPPISTP MGTLANTPPG TFVSTTTAAG  660
NSIRPSSQEK ISSIGTK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G153300.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4578185e-59AM457818.1 Vitis vinifera contig VV78X000502.3, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305423.10.0SWI/SNF complex subunit SWI3D
TrEMBLA0A2K2AV190.0A0A2K2AV19_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16070.10.0(Populus trichocarpa)