PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G144800.1
Common NamePOPTR_0004s15220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 421aa    MW: 46587.1 Da    PI: 7.2687
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G144800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32276331156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k r++W+peLH++Fv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Potri.004G144800.1 276 KHRRCWSPELHRQFVNALQQLGGAQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 331
                         68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-29273334IPR009057Homeodomain-like
PROSITE profilePS5129413.648273333IPR017930Myb domain
SuperFamilySSF466898.78E-18274334IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-26276331IPR006447Myb domain, plants
PfamPF002491.2E-7278329IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGSVPPELSL DFVRPSSTTK TFTSAIKTFT FLPETITDFL KEVSMIGDAA VKGLKVDSFL  60
NDLEEEKRKI DAFKRELPLC MLLLNDAIQV VREELMQCGT SNNQQPVLEE FIPLKKKIDD  120
HGDDRESDGL IKEKDSKDKK NWMSSVQLWI TDDHHPSTDY LFDAKQSFKL ESKTNKKANQ  180
YVNEDAFQAC KGRTAARTFM PFKAYPGSSR KEDDSNREEL PVPALSLLTP GIKSIKEESN  240
STGSRSSCSR SVSTTAPNSE SNLRNGPQSQ QQSSRKHRRC WSPELHRQFV NALQQLGGAQ  300
VATPKQIREL MQVDGLTNDE VKSHLQKYRL HTRRVPPATA SAPANQSAIV LGGLWMAQDQ  360
YGDSSKANSS KSGSPQGPLQ LAVNTGGTST TGGDSMEDDE DAKSEGYSWK SHIHRSGKDV  420
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.1380.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G144800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1475970.0EF147597.1 Populus trichocarpa clone WS0123_L02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006384452.10.0transcription factor HHO6
TrEMBLB9N4V00.0B9N4V0_POPTR; Uncharacterized protein
STRINGPOPTR_0004s15220.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-56G2-like family protein