PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G135100.1
Common NamePOPTR_0004s14270g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 269aa    MW: 29438.9 Da    PI: 8.7245
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G135100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.88.5e-3156112259
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         + +rYkeClkNhAa++Gg+a+DGCgEf+p  geeg+ +alkC+AC+CHRnFHR+e + 
  Potri.004G135100.1  56 KVMRYKECLKNHAAAIGGNATDGCGEFIPG-GEEGSLEALKCSACNCHRNFHRKEIDG 112
                         5789*************************9.999********************9876 PP

2Homeobox18.53.5e-06203258152
                         TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                         +r Rt+ft+eq + + ++ e    k +++ ++  + L ++lg++ r+ kvW +N +
  Potri.004G135100.1 203 KRFRTKFTEEQKQKMLNFAEkagwKMQKLEESVVQGLCQELGIKRRVLKVWMHNNK 258
                         789************8866677778*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2358113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.2E-2858110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-2959110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.97960109IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.5E-28197263IPR009057Homeodomain-like
PROSITE profilePS500718.535200264IPR001356Homeobox domain
SuperFamilySSF466894.03E-19200263IPR009057Homeodomain-like
TIGRFAMsTIGR015651.8E-25202258IPR006455Homeodomain, ZF-HD class
CDDcd000868.31E-4203256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDESSLQKDM PISRNGSYAG GNGHSHTVTS AAAAQVPTIG HSSPSSQQED QRPYKKVMRY  60
KECLKNHAAA IGGNATDGCG EFIPGGEEGS LEALKCSACN CHRNFHRKEI DGECSYDCHH  120
HYPVMSNIGS GRLISGHHNG IIGSPPQGYP TSSFISSRAP PPHQVVVSYK NGGANAITSE  180
SDEKEEDNGG GILTTRPVEK LRKRFRTKFT EEQKQKMLNF AEKAGWKMQK LEESVVQGLC  240
QELGIKRRVL KVWMHNNKHN YVKNSTSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A6e-202012601675ZF-HD homeobox family protein
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and inflorescence. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G135100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1853610.0AC185361.2 Populus trichocarpa clone Pop1-55D12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306012.20.0zinc-finger homeodomain protein 3
SwissprotO647224e-67ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLB9H4310.0B9H431_POPTR; Uncharacterized protein
STRINGPOPTR_0004s14270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.12e-69homeobox protein 21
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  2. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]