PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G131100.1
Common NamePOPTR_0004s13600g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 179aa    MW: 20334.7 Da    PI: 10.718
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G131100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.13.4e-211153345
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        ++++  rqvtfskRr+g++KKA+EL +LC++++a+i+fs+ gk
  Potri.004G131100.1 11 VKDSNSRQVTFSKRRTGVFKKANELATLCGVQIAIIVFSPGGK 53
                        689999**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.918161IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-34160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-27173IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-19323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGRRKIEIEM VKDSNSRQVT FSKRRTGVFK KANELATLCG VQIAIIVFSP GGKPFSFGHP  60
NVEFVAQRFL NRDKKPKVSA GSLVDSQQEA RLEKLNSQLN DILRKLQYER KRGELLEKAM  120
KLKGSEPKLI GELNLDELRK MKGELEELQE KLRGRVTEME ASSSLLLLSK KPTREKHQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G131100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305333.11e-125agamous-like MADS-box protein AGL29
TrEMBLB9H3Z41e-124B9H3Z4_POPTR; Uncharacterized protein
STRINGPOPTR_0004s13600.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-42AGAMOUS-like 29