PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G121800.1
Common NamePOPTR_0004s12120g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 504aa    MW: 55067.6 Da    PI: 5.2634
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G121800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-39138198262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Potri.004G121800.1 138 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNSA 198
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-31135195IPR003851Zinc finger, Dof-type
PfamPF027014.0E-32140196IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975142196IPR003851Zinc finger, Dof-type
PROSITE patternPS013610144180IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MLEPKDPAIK LFGKTIQVTE ISSTTTTDND DSQDQDRPSC ASSSLYDADS DNNKRYHGEE  60
DIEADDKDSV EKSLTEKQED GVSPVATEEP SNPDATSGTS ENPKTPSIEK ESEGLQTSRT  120
EEEDSDTSNS PEKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK NCQRYWTAGG  180
TMRNVPVGAG RRKNKNSASH YRHITIPEAL QNVRADVPNG VYHPSMKTNG TVLTFGSDTP  240
LHESMASVLN LADKTTRNCT RNGSHKPDAV RIPVSYGSGE NSDDHSNGSS VTVSNSIDEA  300
GKSMSKESAM QNCQGFPPEI PCFPGVPWPY PWNSAQWSSP LPPPAFCPPG FPMPFYPAAA  360
YWGCTVPGAW NIPWLPQPSS PKQTSSSSGP NSPTLGKHSR DENMLKSSNS EEGESAKENN  420
TERCLWIPKT LRIVDPGEAA KSSIWTTLGI KNDKPDLIGG RGLFKAFDSK VEKNHEAETS  480
PVLQANPAAL SRSLKFQESS YFG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.76170.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G121800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306032.20.0cyclic dof factor 3
TrEMBLA0A2K2ATH10.0A0A2K2ATH1_POPTR; Uncharacterized protein
STRINGPOPTR_0004s12120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-94cycling DOF factor 3