PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G111100.1
Common NamePOPTR_0004s10990g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 197aa    MW: 22694.1 Da    PI: 5.2669
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G111100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.6e-1582131554
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L +++++ ++
  Potri.004G111100.1  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKVNHVSE 131
                         689****************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1578142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.54280143IPR004827Basic-leucine zipper domain
PfamPF001704.3E-1382131IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-1382155No hitNo description
SuperFamilySSF579596.88E-1482131No hitNo description
CDDcd147023.25E-1983134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQPNEIAGLH YLVPPNSSPY SAHFSMTQDN SQMFQFNQFT NQSYNFQIPP QLQEFSLQAS  60
CMSSHSTSDE ADEQQLSLIN ERKQRRMISN RESARRSRMR KQKHLDELWS QVVWLRNENH  120
QLVDKVNHVS ECHDQVVQEN NQLKEEISEL RQVLTDMQLS SPYPSLKGLE DITCDTAYLR  180
AESSNQSITS SSDLLG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G111100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2101390.0AC210139.1 Populus trichocarpa clone POP113-I04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006384243.11e-144basic leucine zipper 43
SwissprotQ9FMC25e-41BZP43_ARATH; Basic leucine zipper 43
TrEMBLB9NC161e-143B9NC16_POPTR; BZIP family protein
STRINGPOPTR_0004s10990.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-50basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]