PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G082400.2
Common NamePOPTR_0004s08070g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 379aa    MW: 42600.9 Da    PI: 10.6507
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G082400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.4e-32297350255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.004G082400.2 297 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 350
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15294350IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28295350IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-24297350IPR006447Myb domain, plants
PfamPF002496.5E-7298349IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MPLEGVFIEP SSNPVPDLSL HISPPNISSP SSLCNKKNNN ISNKVDASFN LLGRQEATHK  60
PNTVSSMRSD SQAYIELSLA HPTTGLDEES RRSRRNLSSS RAVELPHLNP YHQQSHNHHQ  120
QHHLHHSNST THHLNHINHG VSLLEVSDGL RPIKGIPVYH NRSFPFTPLE HSSRENKDPK  180
MCFYQMPYPS SSFFRPVNPH SSSSTSLPYS IGGGGLDPMS MLNSSGPNQA LPGPYNRLAP  240
TTRFNGLSMD AFKSHQLHHH HHHHNQYGVG STEGSPHGLI RSRFFPKLPT KRSMRAPRMR  300
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKPASS  360
SGSSRWIWRR RHVSNWKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-15298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-15298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-15298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-15298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-15298352458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.004G082400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142140.0AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305235.30.0transcription repressor KAN1
TrEMBLA0A2K2ARM40.0A0A2K2ARM4_POPTR; Uncharacterized protein
STRINGPOPTR_0004s08070.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-60G2-like family protein